KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15400Help
Entry
SPN034183_15400   CDS       T02629                                 

Definition
(GenBank) putative mechanosensitive ion channel protein
  KO
K22044  moderate conductance mechanosensitive channel
Organism
spnu  Streptococcus pneumoniae SPN034183
Brite
Transporters [BR:spnu02000]
 Other Transporters
  Pores ion channels [TC:1]
   SPN034183_15400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel ExoD Virul_fac_BrkB Colicin_V
Motif
Other DBs
NCBI-ProteinID: CCP33250
Position
complement(1569788..1570348)
Genome map
AA seq 186 aa AA seqDB search
MQKFIQAYIEKLDVTTIIENILTKVISLLLLLIVFYIAKKMLHTMVQRIVKPSLKMSRHD
VGRQKTISRLLENVFNYTLYFFLLYCILSILGLPVSSLLAGAGIAGVAIGMGAQGFLSDV
INGFFILFERQLDVGDEVVLTNGPITVSGKVVSVGIRTTQLRSEEQALHFVPNRNITVVS
NFSRTD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttattcaggcttatattgaaaagctagatgtgacaaccattatcgagaat
attctaaccaaggtcatttctcttttactgcttttgattgtattttatattgctaaaaaa
atgcttcataccatggtgcagagaattgtcaaaccttctctaaaaatgtctcgtcatgat
gtcggacgccaaaaaaccatctcacgtttactagaaaatgtgtttaattatacgctatat
ttctttttactctactgcattttgtcgattttaggtttgccagtttctagtttgctggct
ggagctggtattgctggggtagcgattggtatgggagcccaaggctttctgtctgatgtc
atcaatggctttttcatcctctttgaacgtcaactggatgtgggagatgaggtcgttctg
acaaatggaccgattactgtatcgggtaaggttgtcagtgtgggaattcgtacgacacaa
cttcgtagcgaggagcaagcccttcactttgtccctaaccgaaatatcacagttgttagc
aatttctcacgcacagactag

DBGET integrated database retrieval system