KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15410Help
Entry
SPN034183_15410   CDS       T02629                                 

Definition
(GenBank) putative sodium:dicarboxylate symporter family protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDF Nicastrin
Motif
Other DBs
NCBI-ProteinID: CCP33251
Position
1570552..1570740
Genome map
AA seq 62 aa AA seqDB search
MWGILGLTLPNLSGIGLLGDLFVGGLKAVAPILVFALVANALSQHQKGQDSNMKTVVFLY
IL
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
ttgtggggaatcctaggactgacccttcctaatctctcagggattgggctactcggggat
ttattcgttggaggtctaaaagctgttgctcctatcctagtctttgccctcgttgccaat
gccctttcccaacatcaaaagggacaagatagcaatatgaaaactgttgttttcttgtat
atcctatga

DBGET integrated database retrieval system