KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15420Help
Entry
SPN034183_15420   CDS       T02629                                 

Definition
(GenBank) putative sodium:dicarboxylate symporter family protein
  KO
K07862  serine/threonine transporter
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_15420
Transporters [BR:spnu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SPN034183_15420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-ProteinID: CCP33252
Position
1570737..1571762
Genome map
AA seq 341 aa AA seqDB search
MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDNPVNALLTAN
YIRILSWAVIFGIAMREASKNSKELLKTIADVTSKIVEWIINLAPFGILGLVFKTISDKG
VGSLANYGILLVLLVTTMLFVAPVVNPLIAFFFMRRNPYPLVWNCLRVSGVTAFFTRSST
TNIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINLLTLVTVNTLGIPVDFATAF
VLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQIVGVGFVIGVIQDSCETALN
SSTDVLFTAVAEYAATRKKASLLMSCLLRFYSNLLGNSYVY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatagggactttcgccgctgctcttgtagctgtactagcaagtttcatcgtccctatt
gaaattaccctaaatagtgccaatactgaaattgcaccaccagatgggattgggcaggtt
ctcagcaacctcttgctcaaactggttgacaacccagtcaacgccctgcttactgctaac
tatattagaatcttatcttgggcagtcatttttggaatcgctatgagagaagccagtaaa
aatagtaaagaattgctaaaaactatcgctgacgtgacttctaaaattgtcgaatggatc
atcaatctggctccatttggaatccttggtcttgtttttaaaaccatttctgacaaggga
gtcggaagccttgccaactacggtattttattggttctattagtaacgactatgcttttt
gttgcccctgtggtcaaccctttgattgccttcttctttatgagacgcaatccttaccct
ctagtttggaactgcctccgtgtcagcggtgtgacagcctttttcactcgtagttctacg
actaacattcctgtcaacatgaaactctgccatgaccttggactcaacccagatacctat
tctgtttctatcccactcggttctactatcaatatggctggagtagcgattaccattaac
cttttgacccttgttacagttaacactcttggaattcctgttgactttgccacagccttt
gtcctcagtgtggtagcagctatctcagcctgtggtgcttcaggtattgccggaggttcc
ctccttcttatcccagttgcttgtagccttttcggtatttctaacgatattgccatacaa
attgttggggttggttttgtgattggtgtcatccaagactcatgtgaaacagcccttaac
tcttctacagatgtcctctttaccgccgttgccgaatacgcagcaacccgtaaaaaagca
agcctgcttatgtcttgtcttttacgcttttattctaacttattaggaaattcttatgtc
tattag

DBGET integrated database retrieval system