KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15480Help
Entry
SPN034183_15480   CDS       T02629                                 

Gene name
aqpZ
Definition
(GenBank) aquaporin Z
  KO
K06188  aquaporin Z
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_15480 (aqpZ)
Transporters [BR:spnu02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    SPN034183_15480 (aqpZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: CCP33258
Position
complement(1574984..1575652)
Genome map
AA seq 222 aa AA seqDB search
MKKFVAELIGTFMLVFVGTGAVVFGNGFDGLGHLGIAFAFGLAIVVAAYSIGTVSGAHLN
PAVSIAMFVNKRLSSSELVNYILGQVVGAFIASGAVFFLLGNSGMSTASLGENALANGVT
VFGGFLFEVIATFLFVLVIMTVTSESKGNGAIAGLVIGLSLMAMILVGLKITGLSVNPAR
SLAPAVLVGGAALQQVWIFILAPIAGGVLAALVAKNFLGTEE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgttgctgagttaatcggtacgttcatgcttgtgttcgttgggacagga
gctgttgtttttggaaatggttttgatggccttggtcaccttggaatcgcctttgccttt
ggtttggcaatcgtggtggcagcctactcaatcggaactgtttcaggtgctcacttgaac
ccggctgtttcgattgctatgtttgtaaacaaacgtttgtcatcttcagaacttgtaaac
tacatccttggtcaggttgttggagctttcatcgcttctggcgcagtcttcttcctcttg
ggtaattcaggtatgtcaactgctagccttggtgaaaatgccttggcaaacggtgtcact
gtctttggtggtttcttgtttgaagtcatcgcaactttcttgtttgtcttggttatcatg
actgtgacttcagaaagtaagggcaatggcgcgattgctggtttggtaatcggtttgtca
ttgatggcgatgattcttgtcggattgaagattactggactttcagtaaacccagctcgt
agcttggcaccagctgtcttggtaggcggcgcagcccttcaacaagtttggattttcatc
cttgcaccaatcgctggtggagttcttgcagcccttgttgcaaaaaatttccttggaaca
gaagaataa

DBGET integrated database retrieval system