KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15500Help
Entry
SPN034183_15500   CDS       T02629                                 

Definition
(GenBank) putative membrane protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCP33260
Position
complement(1576623..1576778)
Genome map
AA seq 51 aa AA seqDB search
MMFMSLLSVILFVLVVAIFKNVVEGRDVKFELTVELVLIVIYVILYQIVFN
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttatgagcttgttaagcgtcattctatttgtcttagttgtagctattttcaaa
aatgtcgttgaaggtcgtgatgttaaatttgaacttactgtagaactggtattaatagtt
atttacgtcattttatatcagattgtatttaattga

DBGET integrated database retrieval system