KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15510Help
Entry
SPN034183_15510   CDS       T02629                                 

Definition
(GenBank) putative oligopeptidase
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M3_N PSII_Pbs27
Motif
Other DBs
NCBI-ProteinID: CCP33261
Position
complement(1576802..1578598)
Genome map
AA seq 598 aa AA seqDB search
MEQKHRSEFPEKELWDLTALYQDREDFLRAIEKAREDINQFSRDYKGNLHTFEDFEKAFA
ELEQIYIQMSHIGNYAFMPQTTDYSNDEFANIAQAGMEFETDASVALTFFDDALVVADEE
VLDRLGELPHLTAAIRQAKIKKAHYLGADVEKALTNLGEVFYSPQDIYTKMRAGDFEMAD
FEAHGKTYKNSFVTYENFYQNHEDAEVREKSFRSFSEGLRKHQNTAAAAYLAQVKSEKLL
ADMKGYDSVFDYLLAEQEVDRVMFDRQIDLIMKDFAPVAQRYLKHVAKVNGLEKMTFADW
KLDLDSALNPEVTIDDAYDLVMKSVEPLGQEYCQEVARYQEERWVDFAANSGKDSGGYAA
DPYRVHPYVLMSWTGRLSDVYTLIHEIGHSGQFIFSDNHQSYFNAHMSTYYVEAPSTFNE
LLLSDYLENQSNDPRQKRFALAHRLTDTYFHNFITHLLEAAFQRKVYTLIEEGETFGASK
LNSIMKEVLTDFWGDAIEIDDDAALTWMRQAHYYMGLYSYTYSAGLVISTAGYLHLKNSE
TGAEDWLNLLKSGGSKTPLESAMIIGADISTDKPLRDTIQFLSDTVDQIIAYSAELGE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaacaccgttcagaatttccagagaaggaactctgggacttaacagcccta
taccaagaccgtgaggatttcttgcgtgcaatcgagaaagctcgtgaagacatcaaccag
tttagccgtgattacaagggcaatcttcacacttttgaggatttcgagaaggcctttgcg
gaattggaacagatctacattcagatgagccatattggcaactatgcttttatgcctcag
acgacggactatagcaatgacgaatttgccaatattgcccaagctgggatggaatttgaa
acagatgccagcgtagccttgaccttctttgacgatgccttggtggtagcagacgaggaa
gtcttggaccgtttgggtgaattgcctcacttgacggcagctattcgtcaggccaaaatc
aaaaaagcccactatctaggggctgatgtggagaaggccttgaccaatctcggtgaagtt
ttctatagtccgcaggacatttatactaagatgcgagctggggattttgaaatggctgac
tttgaagcccatggcaagacctataaaaacagctttgtcacctatgagaatttctaccaa
aatcacgaggatgctgaggttcgtgagaaatccttccgttccttctcagagggacttcgt
aagcaccaaaatacggctgcagcagcctatctggctcaggtcaagtctgaaaaactcttg
gctgatatgaagggatacgactctgtctttgattatcttctagctgaacaagaagtggac
cgtgtcatgtttgaccgccagattgacctcatcatgaaggactttgcaccagtcgctcag
agatacctcaagcatgttgccaaggtaaatggtcttgaaaagatgacctttgcagactgg
aaattggacttggacagcgccctgaatcctgaagtgactattgacgatgcctatgatttg
gtcatgaagtcggtagaacctttggggcaagaatattgtcaggaagttgctcgttaccaa
gaagagcgctgggtggactttgctgctaacagtggcaaggattccggtggttatgcggcg
gacccatatcgcgtacacccttatgtactcatgagctggacaggccgtttgagcgatgtc
tataccttgattcatgaaatcgggcattctggtcaattcatcttttcagacaatcaccaa
agctatttcaacgcccacatgtcgacctactatgttgaagcaccgtcaaccttcaatgaa
ttgctactcagtgattacttagagaaccaatctaatgacccacgtcaaaaacgcttcgct
ctggctcatcgcttgacagacacctacttccataactttatcacccacctcttggaagca
gccttccagcgtaaggtgtatacattgattgaagaaggagaaaccttcggagcaagcaaa
ctcaacagcattatgaaggaagttttgacagatttttggggcgatgccattgaaatcgac
gacgatgcagctttgacttggatgcgccaagctcactactatatgggcttgtatagttac
acttactctgctggtcttgtcatctcgacagctggttaccttcatcttaaaaactcagaa
actggagctgaagactggctcaatctcctcaaatcaggtggtagcaagacaccacttgag
tcagccatgattatcggtgctgatatttcaacagacaaaccactccgtgataccatccaa
ttcttgtctgacacagttgaccagattatcgcctacagtgctgagttgggggagtaa

DBGET integrated database retrieval system