KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15520Help
Entry
SPN034183_15520   CDS       T02629                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09761  16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
spnu  Streptococcus pneumoniae SPN034183
Brite
Enzymes [BR:spnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     SPN034183_15520
Ribosome biogenesis [BR:spnu03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    SPN034183_15520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrans_RNA PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCP33262
Position
complement(1578609..1579352)
Genome map
AA seq 247 aa AA seqDB search
MQQYFVKGSAISPVTIEDKETSKHMFQVMRLKEEDEVTLVFDDGIKRLARVLDMENRQFE
LVQELNDNVELPVQVTIASGFPKGDKLEFIAQKVTELGASQIWAFPADWSVAKWDGKKLG
KKVEKLEKIALGAAEQSKRNIVPSIKLFEKKADFLAQLDQFDSIIVAYEESAKEGEAAAL
LQAVTGLETGAKLLFIFGPEGGLSPAEIESFEAKGAVLAGLGSRILRAETAPLYALSALS
VLVELEK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagtattttgtaaaaggcagtgctatctctcctgtcactatcgaggacaaggaa
accagtaagcatatgtttcaggttatgcgcttgaaagaagaggatgaggttaccttagtc
tttgatgatggcatcaagcgcttggcgcgcgtgctggatatggaaaatcgtcagtttgag
ttggtccaagaattaaatgacaatgtggaactaccagtccaagtgaccatcgcatctgga
tttcccaagggagacaagctggagttcatcgctcaaaaagtaaccgaactgggtgctagc
caaatctgggcctttcctgcagactggtcagttgccaagtgggatggcaagaaattgggt
aaaaaagttgaaaaactagaaaaaattgcccttggagcagccgagcaaagcaagcgtaat
attgtaccaagtattaaacttttcgagaaaaaagcagattttctagctcagctggaccag
tttgattctatcatagtagcctatgaagaatcagctaaagaaggagaagccgctgcgctt
ctgcaagcagtcactggtcttgaaacaggagccaaactgctctttatctttggtccagaa
ggtggtctgtcacctgcagaaatcgaaagttttgaagctaaaggagcagttttggcaggc
ctaggttctcgtattttgcgagcagaaacagcaccgctttacgccttatcagcccttagt
gttttagtagaattagagaaataa

DBGET integrated database retrieval system