KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15530Help
Entry
SPN034183_15530   CDS       T02629                                 

Definition
(GenBank) ribosomal protein L11 methyltransferase
  KO
K02687  ribosomal protein L11 methyltransferase [EC:2.1.1.-]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spnu03009]
    SPN034183_15530
Enzymes [BR:spnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SPN034183_15530
Ribosome biogenesis [BR:spnu03009]
 Prokaryotic Type
  ribosomal protein modification factors
   SPN034183_15530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PrmA MTS Methyltransf_31 Met_10 Methyltransf_18 Methyltransf_25 Methyltransf_23 Methyltransf_11 PCMT Methyltransf_16 Cons_hypoth95 GCD14 TRM Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: CCP33263
Position
complement(1579354..1580304)
Genome map
AA seq 316 aa AA seqDB search
METWQELKVTVKREGEELVSNLLIELGAQGVAIEDSMDYVGNVDRFGEIFPEVEQQEEIV
VTAYYPETVDVAAVEADLQARLAELTDFMDLGEVKMGTTALAEEDWADNWKKYYEPARIT
HDLTIVPSWTDYEATAGEKIIKLDPGMAFGTGTHPTTKMSLFALEQVLRGGETVLDVGTG
SGVLSIASSLLGAKEIFAYDLDDVAVRVAQENIELNPGMENIHVAAGDLLKGVEIEADVI
VANILADILIHLIDDAYRLVKDEGYLIMSGIIKDKWDMVRESAESAGFFLETHMVQGEWN
TCVFKKTKDISGVIGG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatggcaagagttaaaagttacagtgaagcgtgagggagaggagttggtttcc
aatctcttgattgagttaggtgcccaaggggtagcaattgaagacagcatggactatgtg
ggaaatgtggaccgattcggtgaaattttcccagaggtggagcaacaggaagaaatcgta
gtgaccgcctactaccctgaaacggttgatgtagcagcagttgaagcggatttgcaggct
cgtctggcagaattgaccgactttatggacctaggagaagtcaagatgggcacgactgcc
ttggctgaggaagactgggctgacaactggaagaagtattatgaaccggcacgcatcacc
catgacctgaccatcgtaccgtcatggacggactatgaggcaacagcaggagaaaaaatt
atcaagctggatcctggcatggcttttggtactggaacccacccaactaccaagatgagc
ctttttgccttggaacaggttcttcgtggtggcgaaacggtgctagatgtggggactggt
tcaggggttctctctattgccagctcgcttctgggggctaaagaaattttcgcctatgac
ctggatgatgtggcggttcgtgtggctcaggaaaatattgagctcaaccctggcatggaa
aatatccatgtagcggctggagatttgcttaagggtgtggaaattgaggcagatgtgatt
gtggctaatatcttggcggatatcctcattcatctaatagacgatgcctatcgtttggtt
aaggacgaaggctacctgatcatgagtggcattatcaaggataagtgggacatggtgcgc
gagtcggctgaatcagctggatttttcctcgaaactcacatggttcaaggggaatggaat
acctgtgtctttaagaaaaccaaggatatctctggtgtgattggaggctag

DBGET integrated database retrieval system