KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15620Help
Entry
SPN034183_15620   CDS       T02629                                 

Definition
(GenBank) unnamed protein product
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCP33272
Position
complement(1588457..1588720)
Genome map
AA seq 87 aa AA seqDB search
MKETVVVLAISTKKERGWIKVSTLNDCWSDLGMHFDKSKFGAVFSAPGLYEVEVINNASF
GQNAQYEVIQSRKLGTFAELIEMAKIK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaactgttgttgttctagctatttctactaagaaagaacgaggctggataaaa
gtctccacccttaatgattgttggagtgacctaggtatgcatttcgataaatccaaattt
ggagctgttttctctgctccaggcctttatgaggttgaagtgattaataatgcttcattt
ggacagaatgcccaatatgaggtaattcaatccagaaagcttgggacctttgcagaattg
attgaaatggcaaaaattaaataa

DBGET integrated database retrieval system