KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15700Help
Entry
SPN034183_15700   CDS       T02629                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu00052  Galactose metabolism
spnu00500  Starch and sucrose metabolism
spnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPN034183_15700
   00500 Starch and sucrose metabolism
    SPN034183_15700
Enzymes [BR:spnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SPN034183_15700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: CCP33280
Position
complement(1592503..1593822)
Genome map
AA seq 439 aa AA seqDB search
MGDKKYTVEKANSFIAENKHLVNTQYKPEEHFSAEIGWINDPNGFVYFRGEYHLFYQFYP
YDSVWGPMHWGHAKSKDLVTWEHLPVALAPDQDYDRNGCFSGSAIVKDDRLWLMYTGHIE
EKTGVRQVQNMAFSDDGIHFEKISQNPVVTGTDLPDELIAADFRDPKLFEKDGRYYSVVA
AKHKDNVGCIVLLGSDNLVEWQFESIFLKGGEHQGFMWECPDYFELDGKDCLIMSPMRYQ
REGDSYHNINSSLLFTGKVDWGEKRFIPESVQEIDHGQDFYAPQTLLDNQNRRILIAWMQ
TWGRTLPTHDQEHKWACAMTLPRILRLEDGKLRQFPVKKGQYQIQIDKDCHYHLGNDIDY
LEFGYDSNAQQVYIDRSHLIQKILGEEEQDTSRRYVDIEAKELEVVLDKNSIEIFVNQGE
ASLTATYYLTVPAELSRID
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggagataagaaatacacagtagaaaaagccaatagttttatagcagaaaataaacat
ctcgttaatactcaatataagcctgaagaacatttttcagctgagattggttggatcaat
gatccaaatggatttgtctattttcgtggagaataccatctcttttatcaattctatcca
tatgatagtgtttgggggcctatgcactggggacatgctaaaagtaaggacttggtgact
tgggagcacttgccagtggcacttgctcctgaccaagattatgaccgaaatggttgtttc
tcaggctctgccattgtcaaggatgatcgcctctggctcatgtacactgggcatatcgaa
gaaaaaaccggtgtccgccaagtgcaaaatatggcattttcagatgacgggattcacttt
gaaaagatttcccaaaatccagttgtaactggaacagacttgccagatgagttgattgct
gctgatttccgtgatccaaaactctttgaaaaagatggacgctattactccgtagtagct
gccaaacacaaggataatgtgggctgtatcgttctactagggtccgataacctagtagaa
tggcagttcgaatccatctttttaaaagggggagaacaccaaggctttatgtgggaatgc
ccagattacttcgagttagatgggaaagattgccttattatgtcacccatgcgttatcag
cgtgagggagactcatatcataacatcaactcatcgcttttgttcacgggtaaggtagat
tggggagaaaaacgttttatcccagaatcagttcaagaaattgatcatggccaagacttc
tatgcgcctcaaacattgttggacaatcaaaatcgtcgtatcctgattgcttggatgcag
acatgggggcgtacccttccaacccatgaccaagaacacaaatgggcatgtgccatgact
ttacctagaattctaagattggaagatggcaaactaagacaattccctgttaaaaaaggc
caatatcaaatccaaatagataaagattgtcattaccacttaggaaatgatatagattat
cttgaatttggttatgacagtaatgcgcagcaagtttacattgatcgtagccatcttatt
caaaaaattctaggtgaagaagaacaggacactagtcgacggtatgtagatattgaagct
aaagaattggaagttgttctagataaaaattccatcgagatttttgtcaatcaaggtgaa
gcaagcttgactgcaacttattacttaacggtgccagctgagctatcacgaattgattaa

DBGET integrated database retrieval system