KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15710Help
Entry
SPN034183_15710   CDS       T02629                                 

Definition
(GenBank) extracellular solute-binding protein
  KO
K17318  putative aldouronate transport system substrate-binding protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu02010  ABC transporters
Module
spnu_M00603  Putative aldouronate transport system
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPN034183_15710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_15710
Transporters [BR:spnu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter [MD:M00603] [OT]
    SPN034183_15710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 LPAM_2
Motif
Other DBs
NCBI-ProteinID: CCP33281
Structure
PDB: 

Position
complement(1593832..1595448)
Genome map
AA seq 538 aa AA seqDB search
MKFKTFSKSAVLLTASLAVLAACGSKNTASSPDYKLEGVTFPLQEKKTLKFMTASSPLSP
KDPNEKLILQRLEKETGVHIDWTNYQSDFAEKRNLDISSGDLPDAIHNDGASDVDLMNWA
KKGVIIPVEDLIDKYMPNLKKILDEKPEYKALMTAPDGHIYSFPWIEELGDGKESIHSVN
DMAWINKDWLKKLGLEMPKTTDDLIKVLEAFKNGDPNGNGEADEIPFSFISGNGNEDFKF
LFAAFGIGDNDDHLVVGNDGKVDFTADNDNYKEGVKFIRQLQEKGLIDKEAFEHDWNSYI
AKGHDQKFGVYFTWDKNNVTGSNESYDVLPVLAGPSGQKHVARTNGMGFARDKMVITSVN
KNLELTAKWIDAQYAPLQSVQNNWGTYGDDKQQNIFELDQASNSLKHLPLNGTAPAELRQ
KTEVGGPLAILDSYYGKVTTMPDDAKWRLDLIKEYYVPYMSNDNNYPRVFMTQEDLDKIA
HIEADMNDYIYRKRAEWIVNGNIDTEWDDYKKELEKYGLSDYLAIKQKYYDQYQANKN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaacattctcaaaatcagcagttttgttgacagctagtttagcagtactt
gcagcctgtggctcaaaaaatacagcttcaagtccagattataagttggaaggtgtaaca
ttcccgcttcaagaaaagaaaacattgaagtttatgacagccagttcaccgttatctcct
aaagacccaaatgaaaagttaattttgcaacgtttggagaaggaaactggcgttcatatt
gactggaccaactaccaatccgactttgcagaaaaacgtaacttggatatttctagtggt
gatttaccagatgctatccacaacgacggagcttcagatgtggacttgatgaactgggct
aaaaaaggtgttattattccagttgaagatttgattgataaatacatgccaaatcttaag
aaaattttggatgagaaaccagagtacaaggccttgatgacagcacctgatgggcacatt
tactcattcccatggattgaagagcttggagatggtaaagagtctattcacagcgtcaac
gatatggcttggattaacaaagattggcttaagaaacttggtcttgaaatgccaaaaact
actgatgatttgattaaagtcctagaagctttcaaaaacggggatccaaatggaaatgga
gaggctgatgaaattccattttcatttattagtggtaacggaaacgaagattttaaattc
ctatttgctgcatttggtataggggataacgatgatcatttagtagtaggaaatgatggc
aaagttgacttcacagcagataacgataactataaagaaggtgtcaaatttatccgtcaa
ttgcaagaaaaaggcttgattgataaagaagctttcgaacatgattggaatagttacatt
gctaaaggtcatgatcagaaatttggtgtttactttacatgggataagaataatgttact
ggaagtaacgaaagttatgatgttttaccagtacttgctggaccaagcggtcaaaaacac
gtagctcgtacaaacggtatgggatttgcacgtgacaagatggttattaccagtgtaaac
aaaaacctagaattgacagctaaatggattgatgcacaatacgctccactccaatctgtg
caaaataactggggaacttacggagatgacaaacaacaaaacatctttgaattggatcaa
gcgtcaaatagtctaaaacacttaccactaaacggaactgcaccagcagaacttcgtcaa
aagactgaagtaggaggaccactagctatcctagattcatactatggtaaagtaacaacc
atgcctgatgatgccaaatggcgtttggatcttatcaaagaatattatgttccttacatg
agcaatgacaataactatccaagagtctttatgacacaggaagatttggacaagattgcc
catatcgaggcagatatgaatgactatatctaccgtaaacgtgctgaatggattgtaaat
ggcaatattgatactgagtgggatgattacaagaaagaacttgaaaaatacggactttct
gattacctcgctattaaacaaaaatactacgaccaataccaagcaaacaaaaactag

DBGET integrated database retrieval system