KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15740Help
Entry
SPN034183_15740   CDS       T02629                                 

Definition
(GenBank) LacI family regulatory protein
  KO
K02529  LacI family transcriptional regulator
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spnu03000]
    SPN034183_15740
Transcription factors [BR:spnu03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    SPN034183_15740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_Tnp_ISL3 HTH_24 TnsD TetR_N HTH_AraC HTH_31
Motif
Other DBs
NCBI-ProteinID: CCP33284
Position
complement(1597446..1598447)
Genome map
AA seq 333 aa AA seqDB search
MVEQRKSITMKDVALEAGVSVGTVSRVINKEKGIKEVTLKKVEQAIKTLNYIPDYYARGM
KKNRTETIAIIVPSIWHPFFSEFAMHVENEVYKRNNKLLLCSINGTNREQDYLEMLRHNK
VDGVVAITYSPIEHYLTSGIPFVSIDRTYSDIAIPCVSSDNDAGGREAAKQLISKGCQHL
AFVGGHNTTINETKRRRISFEKYVQEHKIPLSIFDLDETVTDYYGKLESFLEENSSIDGI
FTINDFTALDVIEILEKNGKRIPHDVQIIGYDGIKMAGDRDYLLSTIEQPLEEMAKEAVR
ILFDIIDGKTVNLQTILPVKFVEGKTTKNENKS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacaaagaaaatcaattaccatgaaagatgttgctttagaagcaggagttagt
gttggaactgtttcacgtgtaattaataaagaaaaaggcattaaagaagtaactttgaaa
aaagtggaacaagcgattaaaactttgaattacattccagattactacgctagaggaatg
aaaaaaaatcgaacagaaacgattgcaatcattgtaccaagtatctggcatcccttcttt
tcagaatttgctatgcatgtggaaaatgaagtctataagagaaataacaaattactctta
tgttctatcaatggtacaaatagagagcaagactatctggagatgttgcgtcataataaa
gttgatggagtggttgccattacctatagtccaattgaacattacttgacgtcaggaatt
ccctttgttagtattgaccgcacatactcagatattgccattccttgtgtttcatcagat
aatgatgcaggtggaagagaagcagctaaacaattaattagtaaaggatgtcagcattta
gcctttgtgggcggacataatacaaccattaatgaaaccaaacgtcgtagaatttcattt
gaaaagtatgtccaagagcataaaatacctcttagtatttttgatttggatgagacagtt
actgactattatggaaagctagagagtttcttggaagaaaattcttctatagatggaatt
tttacaatcaacgattttacagctttggatgtgattgaaatactagaaaaaaatggtaaa
cgtattcctcatgatgtccaaattattggatacgatggaattaaaatggctggagataga
gattatctactttcaactattgaacaaccattggaagaaatggcaaaagaagcggttcgt
attttgtttgatataattgatggaaagactgttaatttgcagacaatcctaccagtaaaa
tttgttgaaggaaaaacaacaaaaaatgaaaataagtcttga

DBGET integrated database retrieval system