KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15800Help
Entry
SPN034183_15800   CDS       T02629                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp23 DUF883 Apolipoprotein DHC_N1
Motif
Other DBs
NCBI-ProteinID: CCP33290
Position
1601768..1602376
Genome map
AA seq 202 aa AA seqDB search
MSNEKNTNTNVEKKDATVVAHEIKGELTYEDKVIQKIIGLSLENVSGLLGIDGGFFSNLK
EKIVNSDDVTSGVNVEVGKTQVAVDLNVIVEYQKNVPALYSEIREIVSSEVAKMTDLEIV
EINVNVVDIKTKEQHEADSVSLQDRVSDVAESTGEFTSEQFEKAKSGLGSGFSTVQEKVS
EGVEAVKGAANGVVSHENTRVN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgaaaaaaacacaaacactaacgtagaaaagaaagatgctactgttgtagct
cacgaaatcaaaggggagcttacttacgaagataaagttatccaaaaaatcattggtctt
tcactagaaaacgtttcaggtcttttgggaatcgatggtggtttcttctcaaatcttaaa
gaaaaaatcgttaacagcgatgacgtaacaagtggtgttaacgtagaagttggtaaaaca
caagttgcagttgacttaaacgttattgttgagtaccaaaaaaatgttccagctttatat
tcagaaatcagagaaatcgtatcttcagaagttgctaaaatgactgacttggaaattgtt
gaaatcaacgtaaacgttgtcgacatcaaaactaaagaacagcatgaagcagactcagta
agccttcaagatcgcgtatctgacgttgctgaatcaacaggagaattcacttcagaacaa
ttcgaaaaagctaaatctggtcttggatctggtttctcaactgttcaagaaaaagttagc
gaaggtgtagaagctgttaaaggtgcagcaaatggtgtagtatctcacgaaaacactcgt
gtaaactaa

DBGET integrated database retrieval system