KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15940Help
Entry
SPN034183_15940   CDS       T02629                                 

Definition
(GenBank) putative DNA-binding protein
Organism
spnu  Streptococcus pneumoniae SPN034183
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78 HTH_3 HTH_31 HTH_19 HTH_11 HTH_24 HTH_25
Motif
Other DBs
NCBI-ProteinID: CCP33304
Position
complement(1614294..1615445)
Genome map
AA seq 383 aa AA seqDB search
MFNGRVLKELRLLNGLSRAELAQRINLTEQAIWQFESNETKPKLSTKMHLANQFHVDLTY
FEQEEESIRFDSSVIAFRNADLATRKTIDIQTMYLHKVDSLIDYFESFVIIPNITIHDLS
NVVSESYHKGESIEELALYAREKLGISKDNHDLLYKLERSGIYIVERLINGQADAYSAWS
KLGRPYIVLGTNKSSVRRNFDLAHELGHILLHKYKDMNEDGDRLEQEANYFASCFLLPKE
EFLVKFEERVGKRVSNPDSYILLKSDLNVSIQALEYRAFKLGLLTPKQHSYFYRQIAQKG
YKMIEPLDNQIFVKKPSKVKSILDVVLSNHLVSLATIMSKQSIRLQFISEIFSVEMKFFD
QYQEDRRTDRFDNIIPLYKRNNL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatggtcgggtattgaaagaattacggctgttaaatggtttaagtagagcagaa
ttagctcagagaattaatttaacggaacaagccatttggcagtttgagtccaacgaaacg
aaacctaaattatcaaccaaaatgcatttggccaaccaatttcatgttgatttaacttat
tttgaacaggaagaagagagcattcgatttgattcttctgtaattgcctttagaaatgca
gacctagcaacacggaaaacaatagatattcaaactatgtatttacataaggtagatagt
ttgattgattattttgaaagttttgtaattatacctaatattacaattcatgacctaagt
aatgtagtgagtgaatcttatcataagggagaatccattgaggaattggctctttatgcc
agggaaaaattaggtatttcaaaagataatcatgatttgctttataaattagaacgctca
ggcatctatatcgtggaacgattaattaatggccaagctgatgcttatagcgcatggtca
aaattgggaagaccttatattgtgttgggaacgaataaatcatctgtacgtcgaaatttt
gacttagctcatgagctaggacatattcttttacataaatataaagatatgaatgaagat
ggcgatcgtttggagcaagaagcaaattattttgcatcatgttttttattgccaaaagaa
gagtttttagtcaaatttgaagagagggttggcaagcgtgtcagcaatcctgatagttat
attttattgaagtcggatttgaatgtttcgatacaggctttagagtatcgagcttttaag
ttaggattattgactccaaagcaacattcttacttttatcgtcaaattgcgcaaaaaggt
tacaaaatgattgaacctttggataatcaaatttttgttaaaaaaccaagcaaagtaaag
agtattctggacgtcgttttgagtaatcatctagtcagtctagcgactataatgtctaaa
caaagtattcgtttacagtttataagcgaaatattttcagtcgaaatgaaattttttgat
cagtatcaagaagatagaagaacagatcgatttgataacatcatccctttgtacaaaaga
aataatttataa

DBGET integrated database retrieval system