KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_16080Help
Entry
SPN034183_16080   CDS       T02629                                 

Definition
(GenBank) putative iron ABC transporter, solute-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu02010  ABC transporters
Module
spnu_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPN034183_16080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_16080
Transporters [BR:spnu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    SPN034183_16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_1 SBP_bac_11 LPAM_1
Motif
Other DBs
NCBI-ProteinID: CCP33318
Position
complement(1629037..1630104)
Genome map
AA seq 355 aa AA seqDB search
MKKMKVWSTVLATGVALTTLAACSGGSNSTTASSSEEKADKSQELVIYSNSVSNGRGDWL
TAKAKEAGFNIKMVDIAGAQLADRVIAEKNNAVADMVFGIGAVDSNKIRDQKLLVQYKPK
WLDKIDQSLSDKDNYYNPVIVQPLVLIGAPDVKEMPKDWTELGSKYKGKYSIYGLQGGTG
RAILASILVRYLDEKGDLGVSEKGWEVAKEYFANAYTLQKGESSVVKALDKESPIQYGMI
WGSGALIGQKEQNVEFKVMTPEIGVPFVTEQTMVLSTSKKQALAKEFIDWFGQSEIQVEY
SKKFGSIPANKDALKELPEDTKKFVDQVKPQNIDWEAVGKHLDEWVEKAELEYVK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaagtttggtctactgtacttgcaacgggagttgctcttactacactt
gctgcttgctctggaggttcaaattctacgactgcttcttcatctgaagaaaaagctgat
aaaagtcaagaattagttatctattcgaactcagtctcaaatggtcgtggtgattggtta
actgctaaagcaaaagaagctggttttaatataaaaatggttgatatcgctggcgctcaa
ttagcagaccgtgttattgctgagaagaataatgcagttgcagatatggtatttggaatt
ggtgctgttgactcaaataaaattagagatcaaaaattactagtacagtacaagcctaaa
tggttagataaaattgatcaatctttatcagataaagataattattataatcctgtgatt
gttcaaccattagttttaattggggcgcctgatgtaaaagaaatgcctaaagattggact
gaattaggtagtaagtataaaggtaaatattcaatttatggtcttcaaggtggtacagga
cgggcaattctagcaagtatcttagttcgttaccttgatgaaaaaggagatttaggcgta
tcagaaaaaggatgggaagttgcaaaagaatactttgcaaatgcctatactcttcaaaaa
ggtgaaagctcagttgttaaagcgttagataaagaaagcccaattcaatacggtatgatc
tggggttctggagcgttaattggacaaaaagaacaaaatgttgaattcaaagttatgact
cctgagattggtgtaccatttgtaactgaacaaactatggttttaagcactagtaaaaaa
caagcgttagctaaagaatttattgattggtttggtcaatcagaaattcaagtagaatat
agtaaaaaatttggctctatccctgccaataaagatgccctaaaagagttacctgaagat
acgaaaaaatttgttgatcaagtgaaaccacaaaatattgactgggaagctgttggaaag
catttggatgaatgggtagaaaaagctgaattagaatacgtaaaataa

DBGET integrated database retrieval system