KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_16160Help
Entry
SPN034183_16160   CDS       T02629                                 

Definition
(GenBank) ABC transporter, ATP-binding/permease protein
  KO
K18889  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu02010  ABC transporters
Module
spnu_M00707  Multidrug resistance, MdlAB/SmdAB transporter
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPN034183_16160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_16160
Transporters [BR:spnu02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    SPN034183_16160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran RsgA_GTPase Zeta_toxin SMC_N AAA_16 ATP-synt_ab KAP_NTPase AAA_22 AAA_14 AAA_24 TsaE AAA_29 DUF87 AAA_7 AAA_21 DUF815 cobW AAA
Motif
Other DBs
NCBI-ProteinID: CCP33326
Position
complement(1638974..1640719)
Genome map
AA seq 581 aa AA seqDB search
MSIIQKFWWFFKLEKRRYLVGIVALVLVSVLNLIPPMVMGRVIDAITSGQLTQQDLLLSL
FYLLLAAFGMYYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHA
TNDINSLTRLAGGGVMSAVDASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGR
KTHKAFGESQAAFSELNNKVQESVSGIKVTKSFGYQADELKSFQAVNELTFQKNLQTMKY
DSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTFISYLDMLVWPLMAIGFLFNT
TQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEETLTDIHFSLAK
GQTLGLVGQTGSGKTSLIKLLLREYDVDKGAIYLNGHDIRDYRLTDLRSLMGYVPQDQFL
FATSILDNIRFGNPNLPLSAVEEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRL
AMSRAMILDPDILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLIL
VLQNGQIIERGRHEDLLALDGWYAQTYQSQQLEMKGEEDAE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtccattattcaaaaattttggtggtttttcaagttagaaaaacgccgttatctagtc
gggattgtggccctggtcttggtttccgtcctcaatctcattcctcctatggttatgggg
cgggttattgatgccatcacatcggggcaattaacccagcaggacctccttcttagccta
ttttacttgctacttgcagcctttggtatgtactatttgcgctatgtgtggcgtatgtat
atccttgggacctcttattgcttgggacagatcatgcggtctcgcttgtttaagcatttc
acaaaaatgtcgtcagccttttatcaaacctatcggacgggtgatctgatggcacacgca
accaatgatatcaattccttgactcgtttagcaggtggcggtgtcatgtctgcggtggat
gcctctatcacggctctggtgactttgttgaccatgctctttagcatctcatggcagatg
actcttgttgccattctccccctacctttcatggcctatacgactagtcgcctagggaga
aagactcataaggcctttggcgaatcccaagctgctttttctgaactcaataacaaggta
caggagtccgtatcaggtatcaaagtaaccaagtctttcggttatcaggcagacgagttg
aagtcttttcaggcagtcaatgaattaaccttccaaaagaacctgcaaaccatgaaatat
gatagtctctttgaccctatggttctcttgtttgttggttcgtcctatgttttaacgctt
ttggttggctccttgatggttcaggaagggcagattacagttgggaatctagtcaccttt
atcagctatttggatatgctggtctggcctcttatggccatcggcttcctctttaatact
actcagcgagggaaggtttcttaccagcggattgaaaatcttttgtctcaggaatctcct
gtacaagaccctgagtttcctctggatggtattgaaaatgggcgtttggagtatgccatt
gacagctttgcttttgaaaatgaggaaacactgacggatattcactttagtttggcaaaa
gggcaaacactgggcttggttgggcagacaggctctgggaaaacgtccttaatcaagctc
ctcttgcgtgaatacgatgtggataagggtgccatttatctaaacggtcacgatattcgg
gactatcgtctgacagaccttcgcagtctcatgggctatgttcctcaggaccagtttctt
tttgcgacttcaatcctagacaatatccgctttggcaatcctaacttgcccctttcagcg
gtcgaggaagctactaagctagcccgagtttaccaagatattgtagacatgcctcaagga
tttgatacgctgattggtgaaaaaggagtcagtctttctggtggtcaaaagcaacggttg
gctatgagtcgggctatgattttagaccctgatatcttgattttggatgattccttatcc
gccgtagatgccaagacagagtatgcgattatcgacaacctcaaggagacgcgaaaggac
aagacaaccattatcactgcccatcgcctcagtgctgttgtccatgcagatttgatttta
gtcctgcaaaatggtcaaattatcgaacgaggcaggcacgaagacttgctagctttggat
ggctggtatgcccaaacctaccagtctcagcagttggaaatgaaaggagaagaagatgca
gaataa

DBGET integrated database retrieval system