KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_16230Help
Entry
SPN034183_16230   CDS       T02629                                 

Gene name
xpt
Definition
(GenBank) putative xanthine phosphoribosyltransferase
  KO
K03816  xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu00230  Purine metabolism
spnu01100  Metabolic pathways
spnu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPN034183_16230 (xpt)
Enzymes [BR:spnu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     SPN034183_16230 (xpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: CCP33333
Position
1644015..1644596
Genome map
AA seq 193 aa AA seqDB search
MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEAS
GIAPAVFTAEALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKV
LIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDR
FENGQVVFKEADL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattagaagagcgcatcctcaaggatgggcatatcttgggtgataacatcctc
aaggtagattcctttttaacccaccaagttgactttagcttgatgcgagagattggtaag
gtttttgcggaaaaatttgctgctactggcattaccaaggtcgtaaccattgaagcgtcg
ggtattgccccagccgtttttacagctgaagccttaaacgttcccatgattttcgccaaa
aaagctaagaacatcaccatgaacgaaggcatcttaactgctcaagtctactcctttacc
aagcaggtgaccagcactgtttctatcgctggaaaattcctctcaccagaggacaaggtt
ttgattatcgacgatttccttgctaatggccaagctgctaaaggcttgattcaaatcatc
gaacaggccggtgccacagtccaagctatcggtatcgtgattgagaaatccttccaagat
ggtcgtgatttgcttgaaaaagcaggctaccctgtcctatcacttgctcgcttggatcgt
tttgaaaatggtcaggtcgtatttaaggaggcagatctctaa

DBGET integrated database retrieval system