KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_16240Help
Entry
SPN034183_16240   CDS       T02629                                 

Gene name
pbuX
Definition
(GenBank) putative xanthine permease
  KO
K16169  xanthine permease
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_16240 (pbuX)
Transporters [BR:spnu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SPN034183_16240 (pbuX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-ProteinID: CCP33334
Position
1644596..1645858
Genome map
AA seq 420 aa AA seqDB search
MQTQEKHSQAAVLGLQHLLAMYSGSILVPIMIATALGYSAEQLTYLISTDIFMCGVATFL
QLQLNKYFGIGLPVVLGVAFQSVAPLIMIGQSHGSGAMFGALIASGIYVVLVSGIFSKIA
NLFPSIVTGSVITTIGLTLIPVAIGNMGNNVPEPTGQSLLLAAITVLIILLINIFTKGFI
KSISILIGLVVGTAIAATMGLVDFSPVAVAPLVHVPIPLYFGMPTFEISSIVMMCIIATV
SMVESTGVYLALSDITKDPIDSTRLRNGYRAEGLAVLLGGIFNTFPYTGFSQNVGLVKLS
GIKKRLPIYYAAGFLVLLGLLPKFGALAQIIPSSVLGGAMLVMFGFVSIQGMQILARVDF
ANNEHNFLIAAVSIAAGVGLNNSNLFVSMPTAFQMFFSNGIVVASLLAIVLNAVLNHKKK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcaagaaaaacactcgcaagcagccgttctgggcttgcagcacttactagcc
atgtactcaggatctatcctggttcccatcatgattgcgacagcccttggctattcagct
gagcagttgacctacctgatttctacagatatcttcatgtgtggggtggcaaccttcctc
caactccaactcaacaaatactttgggattggactcccagtcgttcttggagttgcattc
cagtcggtcgctcccttgattatgattgggcaaagccatggtagtggcgctatgtttggt
gcccttatcgcatctgggatttacgtggttcttgtttcaggcatcttctcaaaaatagcc
aatctcttcccatctatcgtaacaggatctgttattaccacgattggtttaaccttgatc
cctgtcgctattggaaatatgggaaataacgttccagagccaactggtcaaagtctcttg
cttgcagctattactgttctgattatcctcttgatcaacatctttaccaaaggatttatc
aagtctatctctattttgattggtctggttgttggaactgccattgctgctactatgggc
ttggtggacttctctcctgttgcggtagctccacttgtccatgtcccaattccactctac
tttgggatgccaacctttgaaatctcatctattgtcatgatgtgtattatcgcaacggtg
tctatggttgagtcaactggtgtttatctagccttgtctgatatcacaaaagatccaatc
gacagcacgcgccttcgcaacggttaccgcgcagaaggtttggccgtacttctcggagga
atctttaacaccttcccttacaccggattttcacaaaacgttggtttggttaaattgtca
ggcatcaaaaaacgcctgccaatctactacgcagctggtttcctggttctccttggactg
cttcctaagtttggcgcccttgcccaaatcattccaagctccgtcctcggtggtgccatg
ctggtaatgtttggttttgtatcaattcaagggatgcaaatcctcgcccgtgttgacttt
gctaacaatgaacacaacttccttatcgcagctgtttcaatcgctgcaggtgtcggtctc
aacaacagtaatctctttgtcagcatgccgacagccttccaaatgttcttctcaaacgga
atcgtcgtagccagcctactcgctattgtcctcaatgccgtattaaatcataaaaagaaa
taa

DBGET integrated database retrieval system