KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1002.01
Entry
SPAC1002.01       CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: FLILHELTA
Other DBs
NCBI-GeneID: 3361519
NCBI-ProteinID: NP_001342961
PomBase: SPAC1002.01
Position
I:join(1798347..1798830,1798960..1799015)
AA seq 179 aa
MLPPTIRISGLAKTLHIPSRSPLQALKGSFILLNKRKFHYSPFILQEKVQSSNHTIRSDT
KLWKRLLKITGKQAHQFKDKPFSHIFAFLFLHELSAILPLPIFFFIFHSLDWTPTGLPGE
YLQKGSHVAASIFAKLGYNLPLEKVSKTLLDGAAAYAVVKVSYFVENNMVSSTRPFVSN
NT seq 540 nt   +upstreamnt  +downstreamnt
atgttaccaccaactattagaatttcaggtctggctaaaaccttacatataccatctaga
agtcccttgcaagctctaaaaggctcatttatcttattgaataagcgtaaatttcattat
tcgccgtttatcttacaggaaaaggtacaatcctcgaatcataccattcggtctgacacc
aaactatggaaacgcctcctaaaaattactggcaagcaagcacatcaatttaaggataag
cctttttctcatatatttgcatttctttttttacatgagctaagtgctatactaccttta
ccaattttcttttttatatttcattcactcgattggacgcccactgggctaccaggcgaa
tatcttcaaaaaggttctcacgtcgcagcttccatctttgccaaattaggatataacttg
cctctcgaaaaagttagcaaaactctccttgatggtgctgctgcttatgctgtagtcaag
gtatcttattttgtcgaaaataatatggtgtcttctacgcgtccgtttgtttccaactaa

DBGET integrated database retrieval system