KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1002.13c
Entry
SPAC1002.13c      CDS       T00076                                 

Gene name
psu1
Definition
(RefSeq) putative beta-glucosidase Psu1
  KO
K01238  SUN family beta-glucosidase [EC:3.2.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPAC1002.13c (psu1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.-  
     SPAC1002.13c (psu1)
SSDB
Motif
Pfam: SUN DUF963
Other DBs
NCBI-GeneID: 2543265
NCBI-ProteinID: NP_593500
PomBase: SPAC1002.13c
UniProt: Q9UR09
Position
I:complement(1821936..1823189)
AA seq 417 aa
MRFFETLALALLTTGALAAPFRHPHHLLNKRDVSVVTSKVYAYTTVTLEAAASAISTNGA
AKEAATAAGDAETTSSVAASVTPAASSSVAASVTPVASSSVAASVTPVSSSAVVDSATSA
AASSSVIPTSSSVVASSSEVASSTTSSAAASATSTGSSSGGFQDGVYDCTDFPSDQSGVV
ALDYLGYGGYSGIQIGDGAGSSCVEGAYCSYACSPGMLKTQWPSTQPSDGETRGGLLCKG
GKLYRTNTAYDNLCENGVGTASVQNTLGQGVAICQTDYPGSENMVIPTYVGGGATSPLSV
TDNANYFQWEGKGTSAQYYVNKAGYTAEQGCQWGTSSGDYGNWSPLVFGAGMTDGTTWLS
ISQNPLTSQLANYNVKIVGADGASVSGTCVFENGAFQNGGSGCTVGITSGSGVFVFY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcgttttttcgaaactttagcacttgctcttcttaccactggcgctttggccgcccct
ttccgccatcctcatcacttgcttaacaagcgtgatgtgtccgtcgttacctctaaggtt
tacgcctataccaccgttactcttgaggctgctgcttccgccatttctactaacggcgct
gctaaggaggctgctactgctgctggagacgctgagaccaccagctcggttgctgcctct
gtcactcccgctgcttctagctcggttgccgcttcagttactcccgttgcttctagctcc
gtcgctgcttcagtaactcccgtcagctctagcgctgtagttgactctgccacttccgct
gctgcctcttctagcgtcattcccacctcctctagtgttgttgctagctctagcgaagtt
gcttcttctactacttcctctgctgctgcttctgctacttccactggcagtagctctggt
ggtttccaagacggtgtttacgattgcactgatttcccttctgaccaaagcggtgttgtt
gctttggattaccttggttatggtggttactccggtatccaaattggtgatggtgctggt
tcctcttgcgttgagggtgcctactgctcttatgcttgctcacccggtatgttgaagact
caatggcctagtactcaaccttctgacggtgaaacccgtggtggtttgctttgtaagggc
ggtaagctttaccgtactaatactgcttacgataacctttgtgaaaacggtgttggcact
gcttctgttcaaaacacacttggccaaggtgttgccatttgccaaaccgattaccctgga
agtgagaacatggttattcctacctatgttggtggcggtgctacctctcctttatctgtc
actgataacgctaactacttccaatgggaaggcaagggtacttctgctcaatactatgtt
aacaaggctggctatactgctgaacaaggatgtcaatggggtacttctagcggtgactat
ggtaactggtctcctcttgtctttggtgccggtatgactgatggtactacttggttgtcc
atctctcaaaaccccttgacttctcaacttgccaattacaatgtcaagattgtcggcgct
gatggcgcttctgttagtggtacctgtgtatttgagaacggtgctttccaaaatggtggc
agtggttgcactgttggcatcacttctggatccggtgtcttcgttttttactaa

DBGET integrated database retrieval system