KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1006.05c
Entry
SPAC1006.05c      CDS       T00076                                 

Gene name
och1
Definition
(RefSeq) alpha-1,6-mannosyltransferase Och1
  KO
K05528  alpha 1,6-mannosyltransferase [EC:2.4.1.232]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00513  Various types of N-glycan biosynthesis
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    SPAC1006.05c (och1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spo01003]
    SPAC1006.05c (och1)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.232  initiation-specific alpha-1,6-mannosyltransferase
     SPAC1006.05c (och1)
Glycosyltransferases [BR:spo01003]
 Glycan extension
  Yeast mannan chain
   SPAC1006.05c (och1)
SSDB
Motif
Pfam: Gly_transf_sug
Other DBs
NCBI-GeneID: 2543147
NCBI-ProteinID: NP_594852
PomBase: SPAC1006.05c
UniProt: Q9UTR6
Position
I:complement(5079186..5080376)
AA seq 396 aa
MLRLRLRSIVIGAAIAGSILLLFNHGSIEGMEDLTEISMLEDYTPEAANKDYVGQQEEEE
LLYDQPSYIEEEEDPDLEAYLSDLEREELEHSLEELDEENNYKLHLRYSFSQLQDFDEEN
EAVHMIVPKDTYEFEVPYHADIPKLIWQTSKDPFDREVMKYTRFWRINHPSYSHAVLDDE
QSKALVISSFGDSSVSKISQAYAMMPLPVLKADFFRYLVLLAKGGIYSDIDTAPLKHINN
WIPREYRKRNIRLIVGIEADPDRPDWNDYYARRVQFCQWTIAAAPGHPILWELVRRITDE
TWKLHDSKKLSKNGESVMEWTGPGIWTDAIMDYLNWQYGPFSVENITNLEEPYLVGDVLI
LPITAFSPGVGHMGSKSPNDPMAYVQHFFAGSWKDD
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgttgagactccgattgagaagtattgtaataggagctgcgatagcgggatccatactg
ttgttattcaatcatggtagcatagaaggaatggaagatttgacagagatttcgatgttg
gaggattacactccggaagccgctaataaagattatgttggtcaacaggaggaggaggaa
cttttgtatgatcaaccgtcttacattgaagaagaagaagatccagatttggaagcttac
ttgagcgatttggagagggaagagctggaacacagcttggaagaacttgatgaagaaaat
aattataaacttcatctacggtactccttttcacagcttcaagattttgacgaagaaaat
gaagctgtacacatgatcgttcctaaagatacttatgaatttgaggtgccttatcacgct
gacattcccaagttaatatggcaaacttccaaggacccttttgatagagaggttatgaag
tacactcggttttggagaatcaaccatcccagttattctcatgctgttttagacgatgag
cagtctaaagcattggtcatcagtagctttggcgattcatcagtttccaagatttcacaa
gcgtatgcaatgatgcctctgcctgttctgaaggccgatttctttcggtatctagtgtta
ttggcaaaaggtggtatttatagcgacattgatacggcaccattgaagcatataaacaat
tggatccctcgtgaatatcgtaagcgtaatattcgactgatcgttggcattgaagcagat
cccgaccgccctgattggaacgactactatgccaggcgtgtacaattctgtcagtggacc
atagctgctgcaccaggccatccaattctttgggaacttgttcgtagaattaccgatgaa
acttggaagctgcatgattcaaagaagctttcgaaaaatggcgagtcagtaatggagtgg
actggtccaggtatttggaccgatgccattatggattatttaaattggcagtatggccct
ttctcggttgagaatatcaccaatttagaagaaccttatcttgttggagatgttttaatc
ctacccataactgcatttagtcctggtgtcggtcacatgggtagcaagtctccaaatgat
ccgatggcgtatgttcaacatttctttgccggttcatggaaagatgattga

DBGET integrated database retrieval system