KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1039.06
Entry
SPAC1039.06       CDS       T00076                                 

Definition
(RefSeq) putative alanine racemase
  KO
K20498  D-serine ammonia-lyase [EC:4.3.1.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00260  Glycine, serine and threonine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAC1039.06
Enzymes [BR:spo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     SPAC1039.06
SSDB
Motif
Pfam: D-ser_dehydrat Ala_racemase_N
Other DBs
NCBI-GeneID: 2542996
NCBI-ProteinID: NP_594997
PomBase: SPAC1039.06
UniProt: Q9US35
Position
I:5460567..5461814
AA seq 415 aa
MASNVDKFSSRFYLNVNKEELKKEYVGKTIQQVPTPGFVIDEAIFEKNCNRMLDRASDIG
VTFRAHVKTHKTIEGTLLQLGDGRTKAVVVSTLMEGFSLIPLILEGKIDDLLYGLPVAKS
RLPELYELSKIVPHLRLMIDNPKQLDILREFTSTLPDDAKPWSIFVKIDMGTHRAGVTND
SQVVKDLISTILSDKSLFDLFGFYCHAGHSYASRSIDAASEFLCAEIDAANTAAKFATSI
DPSLKLTLSVGATPTAHSVSPKVKELLPTLSGKLEVHAGNYPMNDVQQMITKCISQADVA
DYVFAEVISNYPGRNGEPGEVLVNAGVIAMSRETSPEGDFGIVITPGFESFYVDRLSQEH
GILKSKDPKATLPDASQVLCIIPNHSCITAAAFPWYYITKGSDVITDIWVPWKGW
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcttccaacgttgataaatttagctctcgcttctatctgaatgtcaataaggaggaa
ttgaagaaggagtatgttggcaaaactatccaacaagttcctaccccaggctttgtgatc
gacgaagccatattcgaaaagaactgcaatcgcatgctggaccgtgcaagtgatataggt
gttactttcagggctcatgtgaaaactcacaaaacgattgaaggaactttgcttcaatta
ggcgatggaagaactaaagcagtggtggtttctacattgatggaggggttttcattaata
cctctcattttagaaggaaagattgatgatcttctttacggtcttcctgtagctaaatct
aggctccctgaattgtatgagctttctaaaattgtcccacatttacgtctgatgattgat
aatcccaaacaactagacatattacgtgaattcacttccacattacctgatgatgcaaaa
ccatggtcgatttttgtcaagatcgatatgggtactcaccgggccggtgttactaacgac
tcacaagttgttaaggatttgatatcaacgatcttgtctgacaaatcgttgtttgatctt
tttggattctactgtcacgctggtcattcatatgcttctaggtctattgacgctgcttct
gagttcttgtgtgctgaaattgacgctgctaatactgctgctaagttcgctacctccatt
gatccttccttaaaacttactttgtctgttggtgcgacgcccaccgctcattccgtcagt
ccaaaggtaaaagagttattacctactttgagtggaaaacttgaagttcatgctggaaac
tatcccatgaacgatgttcagcaaatgataaccaaatgcatcagccaggcggacgttgcc
gattacgtgtttgcagaagtcattagcaattatccaggtagaaacggtgaacctggtgaa
gttcttgtcaatgctggtgtaattgccatgtctcgcgaaacctctccagaaggtgatttt
ggaattgtaattactcctggatttgagagtttttacgtcgacagattaagtcaagaacat
ggtattttaaaatccaaagatccaaaagccactcttcctgacgcctctcaagttctttgc
atcatccctaatcattcatgtatcactgctgctgcattcccttggtattacataaccaaa
ggctcagatgttatcactgatatttgggtcccttggaaaggttggtag

DBGET integrated database retrieval system