KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1039.09
Entry
SPAC1039.09       CDS       T00076                                 

Gene name
isp5
Definition
(RefSeq) amino acid permease Isp5
  KO
K16261  yeast amino acid transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC1039.09 (isp5)
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPAC1039.09 (isp5)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 2543028
NCBI-ProteinID: NP_595000
PomBase: SPAC1039.09
UniProt: P40901
Position
I:5466778..5468520
AA seq 580 aa
MNNYGVSSIGTSLTPSPTGSIDEYTSKEVKHPEDVKVDASYEKEEVGYGELEVVPERGNL
FQRWYRSFLPPEDGKPQKLKRTLTARHIQMIGIGGAIGTGVWVGSKNTLREGGAASVLIC
YSLVGSMVLMTVYSLGELAVAFPINGSFHTYGTRFIHPSWGFTLGWNYLASFLATYPLEL
ITASICLQFWININSGIWITVFIALLCFVNMFGVRGYGEVEFFVSSLKVMAMVGFIICGI
VIDCGGVRTDHRGYIGATIFRKNAFIHGFHGFCSVFSTAAFSYAGTEYIGIAASETKNPA
KAFPKAVKQVFIRVSLFYILALFVVSLLISGRDERLTTLSATAASPFILALMDAKIRGLP
HVLNAVILISVLTAANGITYTGSRTLHSMAEQGHAPKWFKYVDREGRPLLAMAFVLCFGA
LGYICESAQSDTVFDWLLSISNLATLFVWLSINVSYIIYRLAFKKQGKSYDEVGYHSPFG
IYGACYGAFIIILVFITEFYVSIFPIGASPDAGAFFQSYLCFPVVVIVFIAHALITRQKF
RKLSEIDLDTGFSKYDRLEESDKGPMTAKSLAKSVLSFCV
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgaataattacggggtctcttccataggcacaagtcttacccctagtcccactgggtca
atcgacgagtatacttcgaaagaagtgaagcatcccgaagatgtgaaagtggatgccagc
tatgaaaaggaagaagttggatatggagagctcgaggtggttcccgaaaggggaaacttg
tttcagcgttggtatcgttcttttcttcctcctgaagatggaaaacctcaaaaacttaag
cgtactcttactgcaagacacattcagatgattggtatcggtggtgcaattggtactggt
gtgtgggttggtagtaaaaacacccttcgtgagggtggtgctgcttcggttttaatctgt
tatagcttggttggatctatggtattgatgactgtatactcattgggtgaattggctgtt
gcattccccatcaatggtagttttcacacttatggtactcgtttcattcacccctcatgg
ggcttcactcttggttggaattatttggcaagtttcctggctacatatccattggaactc
atcacggcgtcaatttgtttgcagttttggataaatataaattccggtatttggattact
gtgtttatagctttgctgtgcttcgtcaacatgttcggtgtacgaggttatggtgaggta
gaattctttgtctcttcccttaaagttatggctatggttggttttatcatctgtggtatt
gtcatcgactgtggtggtgtaagaaccgaccatcgaggctacattggtgctactatcttt
agaaaaaatgcctttattcatggatttcatggtttctgctctgtcttttccaccgctgct
ttctcctatgctggtactgagtatatcggtattgctgcttctgagacaaagaaccctgca
aaagcattcccaaaagctgtcaagcaagtctttattcgtgtttccctattttacatctta
gcccttttcgtcgttagtctgttaattagtggacgtgatgaaagattgaccacccttagc
gcaactgctgcaagtccctttattttggcccttatggatgccaagattcgtggattgcct
catgtcctgaacgctgttatcttaatttccgtgcttactgcagctaatggtattacttat
actggaagtcgtactttgcactccatggctgaacaaggtcatgcaccaaaatggttcaaa
tatgttgatcgtgaaggtagacctctattagcaatggcatttgttctttgcttcggtgca
ttgggctacatttgtgaatctgcccaaagtgataccgtctttgactggcttctttccatt
tccaacttagccactctctttgtatggttgagtattaacgtttcctacataatttacaga
ttggcatttaaaaagcaaggcaagtcatacgacgaagtaggctaccactctcctttcgga
atatatggtgcttgctatggagcttttatcattattcttgtttttatcactgagttttac
gtatccattttccctattggtgcctctccggatgccggagcattctttcaaagctacctc
tgtttccctgtagtcgttattgtcttcattgcccatgctttaattacccgccaaaagttc
cgtaagttatctgaaattgacttggatactggcttcagcaagtacgatcgtttggaagaa
tcagataagggaccaatgactgccaagagtctcgccaaatccgtcctatctttctgcgtt
taa

DBGET integrated database retrieval system