KEGG   Schizosaccharomyces pombe (fission yeast): SPAC105.02c
Entry
SPAC105.02c       CDS       T00076                                 

Definition
(RefSeq) ankyrin repeat-containing protein
  KO
K06867  uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPAC105.02c
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank Ank_5
Other DBs
NCBI-GeneID: 2542971
NCBI-ProteinID: NP_593466
PomBase: SPAC105.02c
UniProt: Q9P7I0
Position
I:complement(join(1744748..1744950,1745235..1745519,1745573..1745597))
AA seq 170 aa
MSTEGAKPSEMLIAACRSNNVDMLEEVVHQQEGDGVSFINNARDSLGNDCVHVCTKYGSL
ECLDWLLDISGVNLNNRCRMTGDTPLHFAVMFIKKDQETALRMVEMLMEVGADPLLTNND
GFRPIDLVPGDFHDVFASALEGPAPALQYSADVVADDDDEEEGSGESDEE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtcaactgaaggagctaagccatcggaaatgttaattgcggcttgccgctcgaataat
gttgacatgcttgaggaagttgttcaccaacaggaaggagacggagtgagcttcatcaat
aatgctcgtgattcacttggaaacgattgtgttcatgtctgtacaaaatatggttcccta
gagtgccttgactggcttttagatatatctggcgtaaatttgaataaccgctgtcgtatg
acaggggacacacctttacactttgccgttatgtttataaaaaaagatcaggaaactgct
ttacgtatggtggagatgcttatggaggttggtgccgatccgcttcttaccaacaacgat
ggttttcgaccaattgaccttgttccaggagactttcacgatgtctttgcttctgcatta
gaaggacctgcgcctgctcttcaatattctgcagatgtcgttgctgacgatgacgatgaa
gaagaaggatccggtgagtcggatgaagaatag

DBGET integrated database retrieval system