KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1093.05
Entry
SPAC1093.05       CDS       T00076                                 

Name
(RefSeq) putative ATP-dependent RNA helicase Hca4
  KO
K14776  ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC1093.05
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPAC1093.05
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  90S particles
   Helicases
    SPAC1093.05
SSDB
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Other DBs
NCBI-GeneID: 2541630
NCBI-ProteinID: NP_594652
PomBase: SPAC1093.05
UniProt: Q9UTP9
Position
I:4619693..4621900
AA seq 735 aa
MPKNRTGRSREAREKKRKEEEEEIEELNSQIEALSETVDHFAELPLTQPTKSALKNAHFI
TLTEIQKQCIPSALKGRDILGAAKTGSGKTLAFIVPLIENLYRKKWTSLDGLGALVISPT
RELAIQTFETLVKIGRLHSFSAGLIIGGNNYKEEKERLSRMNILVCTPGRLLQHIDQAVN
FDTSGLQMLILDEADRILDMGFRTTLDAIVSSLPVHRQTMLFSATQTKSVKDLARLSLQN
PDFISVHENDTSSTPSNLNQFYLTVPLTEKLDILFGFIRTHLKFKTIVFLSSCKQVRFVY
ETFRRMRPGISLLHLHGKQKQTTRTEVTAKFTSSRHVVLFCTDIVARGLDFPAVDWVIQL
DAPEDVDTYIHRVGRTARYNRSGNALLLLLPSEEAFLKRLESKKIAVERINVKDGKKTSI
RNQLQNLCFKDNDIKYIGQKAFISYLRSIYLQKDKDVFQLDKLPVEAFADSLGLPGTPKI
TFGKLKNHSQSQKDYNSSTSLDSSEESEVDVENKQNVRTKYDRIFERKNQDVLAAHRQRL
VEVNSDEDDGDFLQVKRVDHDLPEETGERFNANSKRKEKMASSKKAMLKYKKSADKVYFD
DEGNAIPFYAMNTEDTFQKAGDPAALIASHLAEERKALEKADITDKETVRQKQLEKKRRR
QELERITQQDATPDEYVPEGPIVAFVDDELPETSKKQKKWFEDNDERDHGGIVEVENLNS
LEDQEALALKLMGAA
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgcctaagaatcgtactggaaggagtagagaagcccgtgaaaaaaagagaaaagaagaa
gaagaagaaattgaagaacttaactctcaaattgaagcactttctgaaactgttgatcat
tttgcagagttacctcttactcaacctacaaaaagtgcattgaaaaatgcacattttata
acactaactgagattcaaaaacaatgtattccttcagcacttaagggccgtgatatttta
ggtgctgcgaaaacaggaagtggaaaaaccttagcctttatcgtccctttgattgaaaat
ttatatcgaaaaaaatggacctctcttgatggtttgggagcattggtcatttcgcctacg
agagaattggcaattcagacattcgaaacgttggtaaaaataggccgtctacattccttt
tcggctggtctgattattggaggaaataattataaagaagaaaaagaacgtctttctcgt
atgaatatccttgtctgtacacctgggagattgttacaacacattgatcaagctgtaaat
tttgatacttcaggtttacaaatgttgatattagacgaagctgatagaatccttgatatg
ggatttcgcactacgctagatgccattgtttccagccttcctgttcatcgtcagactatg
ctgttttctgccactcagacaaaatctgttaaagacttggctaggttgtcgcttcaaaat
cctgatttcatttcagttcacgaaaatgatacatcgagtacccctagtaacctcaaccag
ttttatcttactgttccattaaccgagaaactggatattctgtttggtttcattcgtacg
catctaaagtttaagacaattgttttcttgtcttcttgtaagcaagtccgttttgtgtat
gaaacttttcggcgcatgcgacccggtatttcacttttacatttgcacggaaaacagaag
caaacaactagaacggaggttactgctaagtttacatcttctcgtcacgttgttttgttc
tgcaccgacattgtcgctcgtggattggatttcccagctgtagattgggttattcaattg
gatgcgcctgaagatgttgatacttatattcatagagttggacgtacagctcgttataat
agaagcggaaatgctctattgcttctacttccttccgaagaagcttttttgaagcgtctg
gaatcgaaaaaaatagctgttgaaagaattaatgttaaagatgggaagaaaactagcatt
cgtaatcaattacaaaacctttgttttaaagataatgacataaagtacatcggtcaaaaa
gccttcatctcttatcttcgctctatttatcttcagaaagataaagatgtgtttcaactt
gacaaacttcctgttgaagcatttgctgattctcttggtttgcccgggactccaaaaatc
acgtttggtaaattgaaaaatcattctcaatctcagaaagactacaactcctccacttct
ttagattcatcagaagaatctgaggttgatgttgaaaataaacagaatgtgcgtaccaaa
tatgatcgtatttttgaaagaaaaaatcaagacgttttagctgctcataggcaaaggctt
gtggaggtcaactcagacgaagatgacggtgacttcctgcaagtgaagcgtgttgatcat
gacttaccagaggaaactggagagaggtttaatgcaaattcaaaaagaaaagagaaaatg
gcgtcatctaagaaggctatgcttaagtataaaaagagcgcagataaagtttactttgac
gatgaagggaacgcaattcccttctatgccatgaatactgaggatacttttcaaaaagct
ggtgatcctgctgctttgattgcttcacatctggcagaagaacgtaaagctttagaaaag
gctgacattactgataaggaaacagtccgtcagaagcagttggaaaagaagcgaagacgc
caagaacttgaaagaataactcaacaagatgcgactcctgatgagtacgtaccggagggg
cctattgtcgctttcgtggatgacgaacttcctgaaacatctaaaaagcaaaagaagtgg
tttgaggacaatgatgaacgagaccatggaggcattgttgaagttgaaaacttgaattcc
ttagaagatcaagaagcacttgctctaaagttgatgggcgcagcttag

DBGET integrated database retrieval system