KEGG   Schizosaccharomyces pombe (fission yeast): SPAC10F6.02c
Entry
SPAC10F6.02c      CDS       T00076                                 

Gene name
prp22
Definition
(RefSeq) ATP-dependent RNA helicase Prp22
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPAC10F6.02c (prp22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC10F6.02c (prp22)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPAC10F6.02c (prp22)
Spliceosome [BR:spo03041]
 Complex C
  Other components
   Step II factors
    SPAC10F6.02c (prp22)
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 ABC_tran AAA_30 AAA_19 SRP54 PhoH AAA_14 T2SSE DUF6317 Flavi_DEAD TsaE Roc
Other DBs
NCBI-GeneID: 2542978
NCBI-ProteinID: NP_593253
PomBase: SPAC10F6.02c
UniProt: O42643
Position
I:complement(join(1206925..1210358,1210412..1210484))
AA seq 1168 aa
MDDLKELEYLSLVSKVASEIRNHTGIDDNTLAEFIINLHDQSKNYDEFKNNVLSCGGEFT
DSFLQNISRLIKEIKPKDDIPTDNVNNGSNSVNGASHDLDSKDVDKQHQRKMFPGLSIPN
STNNLRDRPALMDNAMDELEELSTLAKTRRNDRDSRRDERHYLNGIRERRERSISPSFSH
HSRTSISGQSHSSRSSRGPLLNAPTLYGIYSGVVSGIKDFGAFVTLDGFRKRTDGLVHIS
NIQLNGRLDHPSEAVSYGQPVFVKVIRIDESAKRISLSMKEVNQVTGEDLNPDQVSRSTK
KGSGANAIPLSAQNSEIGHVNPLETFTSNGRKRLTSPEIWELQQLAASGAISATDIPELN
DGFNTNNAAEINPEDDEDVEIELREEEPGFLAGQTKVSLKLSPIKVVKAPDGSLSRAAMQ
GQILANDRREIRQKEAKLKSEQEMEKQDLSLSWQDTMSNPQDRKFAQDVRDSAARQLTSE
TPSWRQATRNANISYGKRTTLSMKEQREGLPVFKLRKQFLEAVSKNQILVLLGETGSGKT
TQITQYLAEEGYTSDSKMIGCTQPRRVAAMSVAKRVAEEVGCRVGEEVGYTIRFEDKTSR
MTQIKYMTDGMLQRECLVDPLLSKYSVIILDEAHERTVATDVLFGLLKGTVLKRPDLKLI
VTSATLDAERFSSYFYKCPIFTIPGRSYPVEIMYTKQPEADYLDAALMTVMQIHLSEGPG
DILVFLTGQEEIDTSCEILYERSKMLGDSIPELVILPVYSALPSEIQSRIFEPAPPGGRK
VVIATNIAETSLTIDGIYYVVDPGFVKQSCFDPKLGMDSLIVTPISQAQARQRSGRAGRT
GPGKCYRLYTESAYRNEMLPSPIPEIQRQNLSHTILMLKAMGINDLLNFDFMDPPPAQTM
IAALQNLYALSALDDEGLLTPLGRKMADFPMEPQLSKVLITSVELGCSEEMLSIIAMLSV
PNIWSRPREKQQEADRQRAQFANPESDHLTLLNVYTTWKMNRCSDNWCYEHYIQARGMRR
AEDVRKQLIRLMDRYRHPVVSCGRKRELILRALCSGYFTNVAKRDSHEGCYKTIVENAPV
YMHPSGVLFGKAAEWVIYHELIQTSKEYMHTVSTVNPKWLVEVAPTFFKFANANQVSKTK
KNLKVLPLYNRFEKPDEWRISKQRKGGR
NT seq 3507 nt   +upstreamnt  +downstreamnt
atggacgatctgaaagaattggagtatttatccttggtatctaaagttgcctctgaaatt
cgaaatcatactggaattgacgataatactcttgcagaatttattattaatttgcatgat
cagtctaagaattacgatgagtttaaaaataatgtcctttcatgtggaggagaattcacc
gacagtttccttcaaaacataagtcgattaattaaggaaattaagcctaaagatgacatt
cccactgataatgtaaataatggtagtaactcggtcaatggagcttcgcatgatttagat
agcaaagatgttgacaaacaacaccaaagaaagatgtttcctggcttaagcatcccaaat
agcacgaataatttaagggatagaccagcgcttatggataatgctatggacgagctggaa
gaactttcgacgttggccaaaacaaggagaaacgatagggattctaggagggatgagcgg
cattacctcaatggaataagggaacgtagagagagatcaattagtcccagtttttcgcat
cattcacgtacctcaatttctggtcaatcacattctagtcgatcatcgcgtggtccattg
ctaaatgctccaacattgtatggaatttattctggtgttgtctcaggtattaaggacttt
ggtgcctttgtaactttggacggctttagaaagagaactgatggtttggttcatatctca
aatatccaattaaatgggagattggatcatccttcagaggctgttagctatggacaacct
gtatttgtaaaagttattagaattgatgaatcagcaaagcgaatcagcctgtcaatgaag
gaggtgaatcaagttacaggtgaggatttgaatccggatcaagtttcacgttctacaaag
aagggtagtggagcaaacgctattccattatcagcccaaaattctgaaattggacatgtg
aatccacttgaaacgttcacttcaaacggtcggaagcgtttaacatcacctgaaatatgg
gagttacagcaacttgctgcatccggtgcaatttccgctacggatattcctgaactcaac
gatggattcaatactaataatgctgcggaaattaatcccgaagatgatgaagacgtagaa
atcgaacttcgtgaagaagaacctggatttctcgcaggacaaaccaaagtttcattaaag
ctatctcctataaaagttgtaaaggccccggatggttcattgtccagagcagcaatgcaa
gggcagattttagcaaatgatagacgagaaataagacaaaaggaggcaaaattaaagagt
gaacaagaaatggaaaagcaagacttatccctctcatggcaagacactatgtcgaatcct
caggatcggaaatttgcccaagatgtgcgagactcagctgctcgtcaacttacttctgaa
actcccagctggcgtcaagcaacacgaaatgcaaatatatcctacggtaaaagaacaaca
ctgagcatgaaagagcaaagagagggtcttccagtttttaaacttcgtaaacagtttctc
gaggctgtctcaaaaaaccaaattttggttctactcggtgaaaccggttccggtaagacc
actcaaatcactcaatatcttgctgaagaaggttataccagtgatagcaaaatgataggt
tgtactcaacctaggcgtgtagctgcaatgtctgttgccaaacgtgtagcagaagaagtg
ggatgtcgtgttggtgaagaggttggttacactattcgtttcgaagataagaccagtaga
atgacccaaattaaatatatgactgatggtatgcttcaacgagaatgtttagttgatcct
cttttgtccaaatattctgtaattattttagatgaagcacatgaaagaaccgttgcaact
gatgtactttttggactgttaaagggaactgttttgaaacggccagatttaaagctaatt
gttacttcagccacgctagatgctgagcggttttcgtcttatttctataaatgcccaatt
tttacgattcctgggcgttcatatcccgtcgaaatcatgtatacaaaacaaccagaagcc
gactatcttgatgctgctttgatgactgttatgcaaatccacttgagcgaaggacctggt
gatatattagtatttctgacaggtcaagaagaaattgatactagttgtgaaatattatat
gaaagaagtaaaatgctaggagattcgattcctgagctagttattttacctgtttattca
gcgcttccttcggaaatacaaagtcgtatttttgaacctgctcccccaggaggtcgtaag
gtagtaattgcaaccaacattgctgaaactagtttaacaattgatggaatttattatgtg
gtggaccctgggtttgtcaagcagagctgctttgatccaaaactaggcatggattctcta
atagttacgccaatttctcaagcacaagctaggcaaagaagtggtcgtgcagggcgtaca
ggacccggaaaatgttatcgtctgtatactgaaagcgcttaccgaaacgaaatgttgcct
tccccgattcctgagatacaacgccaaaatttgtcgcatactattttgatgttaaaggca
atgggaattaacgaccttttgaattttgattttatggatcctccacctgctcaaaccatg
atagccgccttgcaaaatctgtatgcactgtcggccttggacgatgagggattgctgact
cctcttgggcgaaaaatggcagatttcccgatggagcctcaattgtcaaaagtattgatt
actagcgtagaattaggttgctctgaagaaatgttgagtattattgccatgcttagcgta
cctaacatttggagccgaccaagggagaagcagcaagaagctgatcgacaacgagcacaa
tttgcaaatcctgagagtgatcacttaaccttacttaatgtgtatacgacttggaaaatg
aatcgttgctcagataattggtgttatgaacattatatccaagcccgtggtatgcgtcga
gctgaagatgtacgcaaacagcttattcgcctaatggatcggtatcgacacccagttgtt
tcatgtggaagaaagagagaacttattttacgggctttgtgttctggctactttaccaat
gttgccaagcgagactctcacgagggatgttacaaaacgatcgtggagaatgctcctgta
tacatgcatcctagtggagttttatttggaaaagctgcagagtgggtgatataccatgaa
ctgattcaaacgtcaaaagaatacatgcacacggtaagcacagtgaatccaaaatggctt
gtggaagttgcaccaacattctttaaatttgccaatgcaaatcaagtttccaaaaccaag
aaaaatctcaaggtgctaccattgtacaatcgatttgaaaaacccgatgagtggaggatt
tcaaagcaacgaaagggaggtcgttaa

DBGET integrated database retrieval system