KEGG   Schizosaccharomyces pombe (fission yeast): SPAC110.02
Entry
SPAC110.02        CDS       T00076                                 

Gene name
pds5
Definition
(RefSeq) cohesin-associated protein Pds5
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC110.02 (pds5)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    SPAC110.02 (pds5)
SSDB
Motif
Pfam: HEAT_2 Cnd1
Other DBs
NCBI-GeneID: 2541628
NCBI-ProteinID: NP_593535
PomBase: SPAC110.02
UniProt: Q9HFF5
Position
I:1912042..1915659
AA seq 1205 aa
MIKLQFQRNIVPTHDNPLTTSEILKRLRDLLGELTSLSQDTIDRDSVLPVARSLVNNNLL
HHKDKGIRSYTLCCIVELLRLCAPDAPFTLSQLEDIFQVILKILSGLMNQESTYYPQIYE
ILESLSNVKSAVLIVDLPNAEEFLVNIFRLFFDLARKGTTKNVEFYMLDIINQLINEINT
IPAAALNILFAQLISGKGVRQTIGSSDSTNHGPAFQLARNIFHDSADRLQRYVCQYFSDI
IFDSRDSLSDSMTTPEFIFSHNLVLQLWKYAPTTLLNIIPQFENELQAEQTSVRLVAIET
VGLMLQDNAIWSDYPRVWSAFCGRLNDKSVACRIKCIEVASNALQNSLATSEIIENVVQM
LQSKLADTDEKVRVATLKTIEQLTFETFKMQFSVQALKLMGDRLRDRKLNVRLQAIRTLS
QIYNRAYQDLIDGVEYSIQMFSWIPSSLLEVFYVNDETTNAAVEICMAELVLQYLSSDTQ
TRLNRLFLSIKYFSEKAMRVFILLLQRQVKYSELLNYYIECCKNYNGGVMDNDEESITNK
LKKVIDIISSKSSNPTLTEATFRKFAELNDRQSYKMLLQTFSIKSEYQVVLKSIKYLFKR
VSETLSTASLECFRIFVYRSALFAFNKSNVHEIIQLLNEPVKYHNFLKPSEALLQHLPLI
HPNIYGEVVIEVENIIVSSGIESDPKVIKALSQFSKRKKNFSIQTTTAEILRKLCLHGTQ
EQAKQAATIIAITETKEFKLDMITNIVENLEYNGGLPVRLMTLGQLFLYTLEEVEKVADQ
VTEFLVKKVIQRFPEKYDDTHNDEEWCTYEKLDNLTMCKVLAIRVLVNRLRAAAGGTEAL
NIGAPIIKLLKVLLMADGELSPFKNTPKISRAYLRLTASKYFLKLCSIPFYAEHIDFSSY
VQISLLCQDENFDVRNLFLTKLQKQLQLKKLPISYYPLLFLTAVDPEEEIKTKASIWIRS
QVAFFQKTHDFTMEYVATYLIHLLSHHPDISSIESENSLDFIAYIRFYVDTVVNSENVPI
VFHLMQRIKQSYDVIEDGNNYIYVLSDMAQKILQVKSQNFGWSLTTYPKQIKLPYEILRP
IPSIDEKKRIFNKIFITPKMESQIEHAIRTPVSSFAKQTTNKHANLKQKKTHSSKSDKKS
SRRRKNEKRRKLNEQNPNIRNVPERSSSRFQGIRINYSEAPSSSEEISEEEEEISEEDFD
EIEDL
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgataaagttacagtttcaaagaaacattgtcccaacacatgacaatccgttaacgact
tccgagattttaaaacgactacgtgatttactaggagagcttactagcctatcccaagat
actatcgaccgtgactcagtattgccagtagcacgatcattagtaaataacaatttgctc
catcacaaagataaagggatacgctcttatacactttgttgtattgttgaattgcttcgt
ttatgtgcccccgatgcgcccttcactttatcacaattggaagatattttccaagtaatt
ctcaaaattcttagtggtcttatgaatcaagaatctacttattatccacaaatttacgag
atattagagagtttgtcgaacgttaaatctgcagttctaatagttgatctcccgaatgct
gaagaattcttagtaaatatctttcgtctcttctttgatttagcgagaaagggtactacc
aagaatgtcgagttttacatgcttgatattattaaccagttgatcaatgagattaacacc
attcctgctgctgccttgaacatactatttgctcaactaatatcaggaaagggcgtaagg
caaacaattggctcttccgattctactaatcacggtccagcttttcaactagcgagaaat
atttttcatgactcagcagatcgactacaaagatatgtttgccagtatttctcagatatt
atattcgattcaagagattcgctttctgactccatgactactccagaatttatattctcg
cacaatttagttttacaattatggaaatatgcaccaaccacgttattgaacattattcca
caattcgaaaatgaattgcaagctgaacaaactagtgtgcgacttgtggcgatagaaact
gttggtttgatgctccaagacaacgccatatggtccgattatcctagggtatggagtgca
ttttgtggtcggctcaatgataaatcagttgcatgtcgtatcaaatgcattgaagttgct
tccaacgctcttcagaattcattggctacttctgagataattgaaaacgtagttcaaatg
cttcaatcaaagttggccgacacggatgaaaaggtgcgggttgctactcttaaaacgatc
gaacagttgactttcgaaacctttaaaatgcaattttcagtacaggctttgaaactcatg
ggtgaccgtttacgtgatcgtaaactcaatgttcgtttacaagcaattcggacactaagt
caaatttataatagagcatatcaagaccttatagatggtgtggaatactcaatacagatg
ttcagctggatcccttcatctcttttggaagtattttatgttaatgatgaaacaactaat
gcggctgttgaaatttgtatggctgaactggtcctacaataccttagttctgatacgcaa
acaaggttaaacaggcttttcctttcaataaagtattttagtgaaaaagcgatgcgagtt
tttattctacttttacaaagacaagttaagtattcggaactcttaaattactacattgag
tgctgcaaaaattacaatggaggtgttatggataatgatgaagagtcaattaccaacaag
cttaagaaggtgattgatatcatatcatcaaaaagttctaatcctacattaacagaagcc
actttcagaaaatttgcggaacttaatgatcgtcaaagctacaaaatgcttttacaaacg
ttttccattaaaagtgaatatcaagttgttttaaaaagcataaaatatttatttaaaagg
gtttctgaaacgttgagtaccgcaagtcttgaatgttttagaatattcgtttaccgttca
gctctgtttgcttttaataaaagcaacgtgcatgaaataattcaattattaaatgaacct
gtaaaataccacaatttccttaagccgtcggaggctcttttacagcatttaccgctaatt
catcccaacatatatggagaggttgttatagaagttgaaaatattatagtttcttcgggc
attgaatcggatcctaaagtaattaaagctctttcccaattctccaaaagaaaaaaaaat
ttttctatacaaacaacaactgctgaaatactacgaaagttgtgtctacatggaacacag
gaacaagccaaacaggcagcgacgattatcgctataacggagacgaaagaattcaaactc
gatatgataacgaatatcgtggaaaatttggagtataatggaggacttcctgtacggctt
atgactttaggacaactatttctatacactttagaagaggtagagaaggttgctgaccaa
gttacagaatttttagtaaaaaaagttatacagcgctttcctgaaaaatatgatgatacg
cataatgatgaggaatggtgtacttacgaaaaattagataatcttaccatgtgcaaagtt
ttagcaattagggttttggttaatcgactgagggcggcggcaggaggaaccgaagcgtta
aatattggagctcctatcattaagctattgaaagtattgttaatggctgacggtgaatta
agtccgttcaagaatactcccaaaatttctcgtgcttatttacgtctcactgctagcaaa
tattttttaaagttatgttccattcctttttatgcggaacatatagattttagttcttac
gttcaaatctccttattatgccaagatgaaaattttgacgtgagaaatttatttttgacg
aagcttcagaagcagctgcaacttaaaaagttgccaattagttattatcctttattgttc
ctgactgctgttgatccggaagaggagatcaagactaaagcgtctatatggatacgttct
caggttgcttttttccagaaaacccatgattttaccatggaatatgtagcaacatatctt
atccatcttctctctcaccatccagacatatcttcgatagaatcagagaactcgcttgat
tttattgcatacattcgcttttacgttgacactgttgttaatagtgagaacgtcccaatc
gtttttcatctaatgcaacgcataaaacaaagctatgatgttattgaagatggaaacaat
tacatttatgtgctaagcgacatggctcagaaaatattgcaggtgaaatcccagaacttt
ggatggagtttgactacgtatccaaagcaaattaaattaccttacgaaattttaagacca
attccctctatagatgagaaaaagagaattttcaataaaatcttcataacgcctaaaatg
gaaagtcagattgaacatgctataaggacaccagtctcatcttttgcgaaacagactacc
aataagcacgcaaatttgaagcaaaagaagactcatagctcaaagagcgataaaaaatcg
tctagaagaaggaaaaacgaaaaaaggagaaagctaaatgagcagaatcctaatattagg
aacgtgccagaacgaagtagctcaagatttcaagggattcgtataaattattcggaagca
ccgtcttcaagtgaggagataagcgaagaagaggaggaaattagcgaagaagattttgat
gaaatagaggatttataa

DBGET integrated database retrieval system