KEGG   Schizosaccharomyces pombe (fission yeast): SPAC110.03
Entry
SPAC110.03        CDS       T00076                                 

Gene name
cdc42
Definition
(RefSeq) Rho family GTPase Cdc42
  KO
K04393  cell division control protein 42
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04011  MAPK signaling pathway - yeast
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAC110.03 (cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPAC110.03 (cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC110.03 (cdc42)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC110.03 (cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC110.03 (cdc42)
   04031 GTP-binding proteins [BR:spo04031]
    SPAC110.03 (cdc42)
Membrane trafficking [BR:spo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    SPAC110.03 (cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    SPAC110.03 (cdc42)
  Macropinocytosis
   Ras GTPases
    SPAC110.03 (cdc42)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    SPAC110.03 (cdc42)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   SPAC110.03 (cdc42)
  Exosomal proteins of breast milk
   SPAC110.03 (cdc42)
GTP-binding proteins [BR:spo04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    SPAC110.03 (cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 2543027
NCBI-ProteinID: NP_593536
PomBase: SPAC110.03
UniProt: Q01112
Position
I:join(1916108..1916155,1916319..1916387,1916818..1917279)
AA seq 192 aa
MPTIKCVVVGDGAVGKTCLLISYTTNKFPSDYVPTVFDNYAVTVMIGDEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLR
DDPSVQQKLARQHQHPLTHEQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALDPP
VPHKKKSKCLVL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcccaccattaagtgtgtcgtagtaggagacggtgctgtaggaaagacctgtctgctt
atttcctatactacaaacaagtttcctagtgactatgtgccaactgtattcgataattat
gctgtcactgtcatgatcggtgatgaaccatacactcttggtttattcgataccgctggt
caggaggattatgatcgcttgcgtcctttatcctatcctcaaacagacgtctttttggtt
tgttttagtgtaacttctcctgccagttttgaaaatgtgaaagaaaagtggtttcccgaa
gttcatcatcattgtccgggcgtcccgtgcttaattgttggtacccaaattgatttacgt
gatgacccttctgtgcaacagaaactagctcgccagcatcagcatccccttacacatgag
caaggtgaacgattagctcgtgagttgggtgctgtcaagtatgttgagtgttccgctttg
acccaaaaagggttaaagaatgtttttgatgaagctattgtagccgctcttgatcctcct
gttcctcacaagaaaaagtcaaagtgtttggtactgtaa

DBGET integrated database retrieval system