KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1142.08
Entry
SPAC1142.08       CDS       T00076                                 

Gene name
fhl1
Definition
(RefSeq) fork head transcription factor Fhl1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Forkhead FHA Yop-YscD_cpl Fusion_gly FHA_2
Other DBs
NCBI-GeneID: 2541552
NCBI-ProteinID: NP_594272
PomBase: SPAC1142.08
UniProt: O14270
Position
I:3639988..3642219
AA seq 743 aa
MPVAEIKNATQQPSSTNRVQAYAKLEFEKFSFFVQTLQVTMGRKASNSSDCDVHLGDTKA
ISRQHAKIFYSFPNQRFEISVMGKNGAFVDGEFVERGKSVPLRSGTRVQIGQISFSFLLP
EGSEEDGHLKETGITPLSLQQGKIAYSDEFGGKPTGSFHTVTSNQEKDLLFSHIKHESDL
PLGLSPADTNISNATSIIEHPDAANAHTLASLNQPPKHLTVSPSSIQRLSPQPYVRPTSD
ERPIETDSSVSAPKVANHDEELKQGKSTSPSDTVLHPDLNGSPDTGDATQKPNLSYANLI
ARTLIANPNKKMTLGDICEWIANNWSYYRHQPPAWHNSIRHNLSLNKAFIRIPRRQNEPG
KGSFWMLDPSYIDQFEGNFFRRTKKPTPSATPAAHPDTARENELAAIQTKGISAGKTEQL
NPQKETSRSKTHTSRGENVEDRPQSLLQNGIQPIIMRDGKLALNPEFFKNANGEQQAPNE
QAVQAISLLQQHINKQLGPAAANNPEQATAIANALAVALAQKLQKQQTQMQGPQQVQQQA
KRRKAYTSQQLNPAPTAMPHPNITSPSPSISVTQRPAVNVGPPPYVRPSAPSKLPDTRQS
IGDPLPPGAMANVSAGPSSVRSSSYNSTASESKSEITSHQNLHTIPINKPFTSDRPLYSS
PNDTLERVETGNQGQRMNSIGNASSFSKRDIMENENGSFDTNAKNGNNVDDSSSVRGMNL
PSNSSDALRGVKRPLDETSSSYT
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgcctgttgcagagataaaaaatgcgacgcaacaaccatcaagcacgaatagagttcag
gcatatgccaagctcgaattcgagaagttttcctttttcgtgcaaacgttacaagtgaca
atgggtcgaaaggcgagcaattcaagtgattgcgatgttcacttgggcgatactaaagcc
atctctcgccagcatgcaaagatattttacagctttcctaaccaaagatttgaaatttcg
gttatgggaaagaatggtgcctttgttgatggcgaatttgtggaaagaggaaaatcagtc
cctttgcgcagcgggacgcgggttcaaatcggtcaaatttcgttttcgtttctattgcca
gaaggatcggaggaggacgggcatctaaaagaaacaggaatcaccccgctatcattacaa
caagggaaaatagcatattcagatgaatttggaggaaaaccgacaggttcatttcacacc
gtgacgtctaatcaagaaaaggacttattgtttagtcatattaagcatgagtctgatctt
ccgttaggtctttcacctgctgacacgaatatctcaaatgccacctctataatcgaacat
cctgacgctgcaaatgctcacactttagcttccctaaaccaacctcctaagcatcttact
gtttccccttcttcaatccagagattgagtccccaaccttacgttcgacctacatctgat
gaacggcctattgaaaccgactcttccgtttctgcacctaaagtcgcaaaccatgatgaa
gagttaaaacaagggaaatctacttctccatctgatacagtgttacatccggatttaaat
ggatcacccgatacaggcgatgctactcaaaaacctaatctctcgtatgctaatttaatc
gcacgtactctaattgccaaccccaacaaaaagatgacactgggagacatatgtgaatgg
attgctaacaattggtcctattatcgacatcagcctcctgcttggcataattccatacga
cataacttatcattaaacaaagcattcattcggattccgagaaggcaaaacgagccagga
aaaggctccttttggatgcttgacccctcttacatagatcaatttgagggtaatttcttt
agaagaacaaaaaagcccaccccttctgctacaccagctgctcatcctgatactgctagg
gagaatgaattagccgctatccagacaaagggtatatcagctggaaaaaccgaacagctt
aatccgcaaaaagaaactagtcgtagtaaaactcatacttcccgaggagaaaatgtagag
gatcgaccacaatccttacttcaaaatggcattcaacctatcattatgcgcgatgggaaa
cttgctttgaaccccgagtttttcaagaatgcaaatggagagcaacaggctcccaacgag
caagccgttcaagcaatttcactactccaacagcacattaataagcagctaggacctgcc
gctgccaacaacccggagcaagccacagcgattgcgaatgctctcgctgtggctttagcc
caaaaacttcaaaagcagcaaacgcaaatgcaagggccccaacaagtgcaacaacaggca
aagcgtcgtaaagcttatacttcacagcaacttaatccggcgccgactgcaatgccgcac
cctaacataacatcaccgtctcctagtatctcagtcactcaacgtcctgcagtaaacgtt
ggaccacctccatatgttaggccatctgctccttcgaagttaccagatacacgccagagt
attggagacccgttacccccaggagcaatggctaatgtgtccgcggggccatcgtcagtt
cgatcatcgtcgtacaactccactgcttctgaaagcaaatcagagataacaagccatcaa
aatctacacaccataccaataaacaaaccattcacttctgatcggcctttatactcttcg
cctaatgatactttagagagagttgaaacaggcaatcaaggacaaaggatgaattccatt
ggaaatgcatcaagctttagtaaaagagatataatggaaaacgaaaatggatcttttgat
actaatgcaaagaacggaaacaatgttgacgactcatcttcagtaaggggcatgaattta
ccatcaaactcaagcgacgctttacgaggagtaaagcgaccgttggacgagacatcatcc
tcttatacctga

DBGET integrated database retrieval system