KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.01c
Entry
SPAC11E3.01c      CDS       T00076                                 

Gene name
swr1
Definition
(RefSeq) SNF2 family helicase Swr1
  KO
K11681  helicase SWR1 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC11E3.01c (swr1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAC11E3.01c (swr1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   SWR1 complex
    SPAC11E3.01c (swr1)
SSDB
Motif
Pfam: SNF2_N Helicase_C ResIII HSA DEAD
Other DBs
NCBI-GeneID: 3361561
NCBI-ProteinID: NP_001342781
PomBase: SPAC11E3.01c
Position
I:complement(5277498..5281364)
AA seq 1288 aa
MTYEESEKNKNGLSSYIKKEGSSDLKVRVRFREPKLLVTHSGHITEQPKYEHLEQYLDSY
VSLEDGDHDPKEAKELVFREVQLRHRINEFRKKGYFTAEAPVELKKAPSSNNIPISYRDN
LLSHVNGYARSMHNDRKVRASRSRRISGMILAHFKRLSGADEKKAKEEDKRIRLLAKRTA
WEIRKKWKVIEREVRRRRAERAAEAQRVAGKEQLANILKHSTDLLEARIERANINISAQT
SESAVDWNYLLKTSDDLLSVDELKLKYSNPDLIKNIEREEEAEETSDDEPLSSEDEENED
EDITEESNLRKRKVSDKTRVVNKHPPSLRRSRRFFAKKSYNHVSDLDGEVIVMKKEDITD
GVSTKKDLNDGDQNEVPLHDTGSSSSLSLLYNEDVASKKKRRVNDDGLARKKSIAGISEQ
RKFDEPNGSPVLHANKIQVPFLFRGTLREYQQYGLEWLTALHDSNTNGILADEMGLGKTI
QTIALLAHLACEKENWGPHLIIVPTSVMLNWEMEFKKFLPGFKILTYYGNPQERKEKRSG
WYKPDTWHVCITSYQLVLQDHQPFRRKKWQYMILDEAHNIKNFRSQRWQSLLNFNAEHRL
LLTGTPLQNNLVELWSLLYFLMPAGVTQNNSAFANLKDFQDWFSKPMDRLIEEGQDMNPE
AMNTVAKLHRVLRPYLLRRLKTEVEKQMPAKYEHVVYCQLSKRQRFLYDDFINRARTREI
LASGNFMSIINCLMQLRKVCNHPNLHEERPIVTSFALRRSAIADLEIKDLLVRKRLLHEE
PMTKLDLSTLRLIRTDSEAFDTFVSDELNSLCATNAYNRISTFLRMQIDEECKPCQFKKS
NFKEHFQNKIYQEQLDKLNFQKYLNESKCSHSPIYGSNLIRLAEKLPKHSTSIDYTLYAK
DDPLYLLNTTKALRSCILSTEERASNMKEIIQRFACITPKAVVVDLPELFCKTIPRDLLY
EVSRKINPLHQASTRLAIAFPDKRLLQYDCGKLQVLDRLLKDLVSNGHRVLIFTQMTKVL
DILEQFLNIHGHRYLRLDGATKIEQRQILTERFNNDDKIPVFILSTRSGGLGINLTGADT
VIFYDSDWNPQLDAQAQDRSHRIGQTRDVHIYRLISEYTVESNMLRRANQKRMLDKIVIQ
GGEFTTEWFRKADVLDLFDLDDESLKKVKADSDSGSTKNEENWEVALAAAEDEEDVQAAQ
VARKESALEQTEFSETSTPQAMLTKDSTPLSSDSATPGFERDSTEEQSNTNDMDEDRSEL
EEDLDETVGHIDEYMISFLEQEGTSDEW
NT seq 3867 nt   +upstreamnt  +downstreamnt
atgacttacgaggagtcagaaaagaacaaaaatggacttagttcctatattaagaaagaa
ggatcttcagatttaaaagtacgcgttcggtttcgcgaaccaaagctgttggttactcac
agtgggcatatcactgaacagccaaaatacgaacatttagagcaataccttgattcatat
gtatctttggaagatggtgatcacgatccgaaagaagcaaaggaattggtttttcgcgag
gttcaactccgacatagaattaatgagttcagaaaaaagggttactttacagcagaagct
cctgtagagctgaaaaaggcacctagttccaataatattccaatatcatacagagataat
cttctatctcatgtcaatggttatgctcgctctatgcataatgataggaaggtgcgagct
tcgcgttcgcgccgaatatctggtatgattttagcacattttaagcgactttcaggtgca
gatgagaaaaaggccaaagaggaggacaagcggatacgtcttttggcaaaaagaactgct
tgggaaatccgaaaaaaatggaaagtcattgaaagagaagttagacggagacgtgctgaa
agagcagctgaagctcaaagagtagcaggaaaagaacagttggccaacattttgaaacat
tctactgatttgcttgaagctagaattgaaagagccaatattaatatcagtgcgcaaaca
agtgaatcagccgtagactggaattatttattaaaaacatcagacgatctactatctgtt
gatgagttgaaacttaagtatagtaatccggacttaatcaaaaatatagaacgtgaagag
gaagcggaagaaacttcagatgatgaaccgttgagttccgaagatgaagagaatgaagac
gaggatattacagaggaatcaaatttaagaaaacggaaggttagtgacaaaactcgtgtg
gtgaataaacatccaccctccctgcgaagaagtcgtcgattttttgcaaaaaaatcatac
aaccacgtatcggatttggatggagaagtgatagtcatgaaaaaagaggacattactgat
ggtgtgtctaccaaaaaggatctcaatgatggagaccaaaatgaagttccactacacgat
actgggtcgtcgtcaagcttgtctctgttatacaatgaagacgttgcaagtaaaaagaag
agacgagtaaacgatgacggtcttgcacggaaaaaatcaatagcaggaatttctgagcaa
agaaaatttgacgaacctaatgggagccctgtcttacatgctaataagatccaagttcct
tttctctttagaggaactcttagggaatatcaacagtatggacttgaatggcttactgcc
cttcatgatagcaataccaacggtatacttgctgatgaaatgggtcttggaaaaacgatt
caaacgatagccttactggcccatctcgcctgtgaaaaagaaaattggggccctcattta
attattgtaccgacaagtgtaatgcttaattgggaaatggaatttaagaaatttttgccg
ggatttaaaattctaacgtattatggcaatccccaagaaagaaaagaaaaaagaagtgga
tggtataaacccgacacttggcatgtctgtattacttcatatcaacttgttttacaagat
catcaaccctttagacgcaaaaaatggcagtacatgattttagatgaagctcacaatatt
aaaaatttcaggtctcaacgttggcaatctcttctgaactttaatgcagagcatcgatta
ttgcttaccggaactcctttgcaaaataatttagtcgaattatggtcacttctgtatttc
ttgatgcctgctggcgtgacacaaaataactctgcttttgctaatttgaaggattttcaa
gattggttttcaaaaccgatggatcgtttaatagaagaaggtcaggatatgaatcctgaa
gcgatgaacacagttgccaagcttcatcgtgtactcagaccttatttacttcgccgttta
aaaacagaagttgaaaagcagatgccagctaaatatgagcatgttgtgtattgccagctc
tctaagcgacaaaggtttttgtacgatgattttataaaccgtgctcgtactagagaaatt
ttggcatctggaaattttatgagcattattaattgccttatgcaacttcgaaaagtatgt
aatcatcccaatttgcatgaagaaagaccaattgtcacatctttcgccttgcgaagatct
gccattgctgatttggaaattaaagacttattggttcggaaacggttattgcatgaagag
ccaatgacgaaattggatctttctacgttaagattaattcgtacagattcggaagcgttt
gacacttttgtttctgatgaattgaatagtctttgcgcaacgaatgcttacaatagaata
tctacatttctaagaatgcagattgacgaggaatgcaagccctgtcaattcaaaaaatcc
aactttaaagagcactttcaaaataaaatttatcaagaacagcttgataaactaaatttc
cagaagtacttgaatgaaagtaaatgctctcattcacccatatatggaagcaaccttatt
cgattggccgaaaagcttccaaagcattcaacatcaattgattatacgctttatgctaaa
gatgatccactttatttactaaatactacgaaagcattgcgcagttgcatcttaagtact
gaagagagagcttcgaatatgaaggaaatcatacaacggtttgcttgtatcactcctaaa
gcggtagtggtagatctaccagaactgttttgtaaaacaattcctcgagatttactatat
gaggtatctagaaaaattaatccgctacatcaagcttcaactagattggctattgctttt
cctgataagcgactgttacaatatgattgtggtaaactgcaggtactggaccgtttattg
aaagatttggtttctaacggacatcgagtattaatctttacccagatgacaaaagtcctg
gacattttagaacaattccttaatattcacggacatcgctatttacgtcttgacggagct
accaagatagagcaaagacaaatactaactgaacggtttaacaatgacgataagattcca
gtttttatactttcaacgagaagtggtggtttaggtataaacttaactggcgctgacact
gtaattttttatgactcggattggaatccacaattggatgcgcaagctcaagatagatca
cacagaattgggcagacccgtgatgtgcacatttatcgtttgattagtgaatatacggtt
gaatctaatatgttgcgtcgggccaaccaaaaacgaatgctggataaaatagtcatccag
ggtggagaatttactactgaatggttccgtaaagctgatgtacttgatctatttgatctg
gatgacgaatcactcaagaaagtcaaagctgattctgattctggttctacaaaaaacgag
gaaaactgggaagtagcattagccgctgctgaagatgaagaagacgtccaagctgctcaa
gtggcccgaaaagaaagtgctcttgaacaaaccgagttcagtgaaacatctactcctcaa
gctatgttaaccaaagactctactcctctatcgtctgatagtgcaacccctggttttgaa
agagactcaacagaggaacaatcaaacacgaatgacatggatgaagatagaagtgagtta
gaggaagacttggatgagactgtggggcacattgatgagtacatgatttcgtttttggaa
caggaaggaactagtgatgaatggtaa

DBGET integrated database retrieval system