KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.02c
Entry
SPAC11E3.02c      CDS       T00076                                 

Definition
(RefSeq) C2 domain protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MUN C2
Other DBs
NCBI-GeneID: 2542968
NCBI-ProteinID: NP_594926
PomBase: SPAC11E3.02c
UniProt: O13683
Position
I:complement(join(5281940..5285570,5285617..5285699))
AA seq 1237 aa
MNCRRKPLPLHSNEVQAAESISKDELYSWTLKNVLILFLVQYRASTPSALQTSSFSTPVE
KKTNGAFSGSLFSAKEKKDNPKYPKDFIKYLSLALESISMGKEPEYQDQLIRGCFAAFYN
NINKSHISKQLKDSRKIEDMFLIFASSVSSELTKRLGTAYDSNLADRITASFIELCKRVT
LKGQLASPSSEFVSHLDMYHSKLLNKSEILSTKRVNRGQDQFDLSSFPLLKVFSSVFKVA
YSKALLDAEKLFPSIDEAAIAEDIGILIEDLESDACKFSHSVVDFSNYKSYSTWKARELQ
TLEQHRKIMLSLIPLSSSPNHPIQPIGFPASRKTPTYVPPIARPYFRQLLSLCLEYRLQV
TDPVEVKQINTFIRECSIYWRILPSTRCALSMDFAREHLQKGLITSADVLTHFGELHKSL
KEWEITYWPKIDVSIFSSALFGIRNALAQLLKKSLLDLLHEKKADFHRWLNIMSICVEDG
KVINQDLSPKSEISSVALALQEHCKVIFDEEFDLSKLPSSNFLDEIILASNRISVRIKFL
ERNCSECIYGVLSLPQIFINIVLPNYIRAALVVAKEYLREKANADINDLTKDMLEIYSDL
KQMIHVLQEYHNEEYRIGSFEGFFQPFIDSWLDNVEASAEQWFLRSLEKDNFDENSSEGQ
YSSSIVDLFHAFHQAFRTLEGFEWEDDLANARFFTRFFRVIYIVLSKYTQWTTQKFFEEA
NKQDDTSEVQNDNSSSWFSKARNILSGSNEVLPFRFSPTMCILLNNIHFAMHAYEELEQK
IDLQRLIEALDVAESTKRHKISATNYLYTIKVVRGEGLHPDGAGKIRTSYIVLTDNKGRR
IGKTRPIHSMNPRWDDTFEVKTKDALMITANLWSKGKFNDHEIFGRSSFTLSPKIYGDYL
PREEWFDLNPHGELLLRIEMEGEREHIGFYVGRTYHDLERAQREMIKFIVNKMEPVINQN
LSTATLKKLLSANTWMDLDKTMTSVTSLLNRTGFSSKSSENVKKEGELTDVQIEAAIYEL
LDYFDLNFSIIAKHLTKDVFVTVMSYVWDEVVCTTEELLLPPVSVKPINRKPLSPAQMAI
VYRWLQFLKDYFYANGEGVKLPVLETDHYKELLRVQEYYDKPTDFLLQECDKIASQLYLS
SRMVNNEPVESLPRHSRIKFANKEIYRSGTIRKVHIQTNESELERNERIILRILRMRADS
KRFLSKHFQRKGRLLMADAMRNGYVMPLGHLKKLDSR
NT seq 3714 nt   +upstreamnt  +downstreamnt
atgaattgtagacgaaaacctcttcctttacactcgaacgaagttcaagctgcagagtct
ataagtaaagatgagctctatagctggactttaaagaatgtgttaatcctgttcttagta
cagtatcgtgcatctaccccttcagctctgcagacatcatcatttagtacaccagttgag
aaaaagaccaatggggcattttctggtagtctattttctgccaaagaaaaaaaagataat
ccaaaatatcccaaggattttataaaatatttatcgcttgcccttgagagtattagtatg
ggaaaagagccagaatatcaagatcagttgatcagaggatgtttcgcagcattttacaat
aacataaacaaatctcatatatctaagcaattaaaagactcgaggaaaattgaggatatg
tttttgatttttgccagctctgtttcatctgaacttactaaacgtttgggaacagcttac
gattcaaatttagcagacagaattactgcttcctttattgagttatgcaaaagagtcacg
cttaaaggccaattggcttccccatcatctgaatttgtatcccatcttgacatgtatcac
tcaaagcttctcaacaaaagtgaaatactgagtacaaaacgcgttaatagaggacaagat
caatttgacctttcatcttttcctttgttaaaagttttttcgtcagtattcaaggttgct
tattcaaaagcattgttggatgctgaaaaattatttccctcaatagatgaggccgccata
gctgaagatattggcattttaattgaggatttagaaagtgatgcttgtaaattttcgcat
tcggtggtcgatttttctaattataaatcatactccacttggaaagctcgtgaacttcaa
acactagaacaacatcgtaaaatcatgttaagtttgattcctctttcttcatcaccaaat
caccctattcaaccgattggttttcctgccagtagaaaaacgccgacatacgtgccgcca
atagcgcggccttactttcggcaacttctatcgctatgtcttgaatacagattacaagtt
acagatcctgttgaagtcaagcaaataaacacatttataagggagtgctccatttactgg
agaatattgccatccactcgctgtgctttgagtatggattttgcacgcgaacatttacaa
aaagggttgataacttcagcagacgttttgacacatttcggtgagcttcataagtcactc
aaagaatgggagataacatattggccaaagatcgatgtttcaatttttagttctgcattg
tttggaatcagaaatgcattagctcaacttttaaagaaatcacttttagatttgttgcac
gaaaaaaaggctgattttcatcgttggttaaatataatgagcatatgtgttgaagatggt
aaggtgatcaatcaagatttgtctccgaaaagtgagatctcttctgttgcattggctctc
caagagcattgtaaagtaatatttgatgaggaatttgatctttcgaaattaccctcttct
aattttcttgacgaaatcatattagccagtaacaggatatctgtacgaattaaattcttg
gaaaggaattgttccgaatgtatttacggagttttgtcacttccacaaatctttataaat
attgttcttcctaattacatacgcgcagcgctagttgttgcgaaagaatatttgagagaa
aaagccaacgctgatattaatgatttgactaaagatatgcttgaaatatatagtgactta
aagcaaatgatacatgtccttcaagaatatcacaatgaggagtatcgtattggaagtttt
gaaggtttttttcagccattcattgattcttggctcgacaatgtcgaagccagtgcagag
caatggtttttgagatctttagagaaggacaattttgatgaaaattcttcagaaggtcag
tacagtagttctatagtagacctgtttcatgcttttcatcaagcttttaggactttggaa
ggatttgagtgggaagacgatttagcgaatgctcgtttttttactcgattctttagagtt
atttatattgtactttcaaagtatactcagtggactacacaaaaattttttgaagaagct
aataaacaagacgatacgagtgaagttcaaaatgacaatagctcatcgtggttttcaaaa
gctaggaatattttatccggaagtaatgaggtattgccttttcggttttcaccaacaatg
tgtattttgctaaacaatattcattttgccatgcacgcttatgaagaacttgaacagaaa
atagatctccagcgtctaatagaggcattagacgttgctgaatctactaaacgtcataaa
atttctgccacaaattatttgtacacaattaaagttgttagaggagaaggattacatcct
gatggcgccggtaaaattcggacgtcttacattgttttaactgacaataagggtcgtcgt
attggtaaaactcgaccgatacattcaatgaatcctcgttgggatgatacttttgaagta
aagacaaaggacgcattaatgattactgctaatttatggtcaaaaggaaaatttaatgat
cacgaaatatttggcagaagttcctttacattaagcccaaaaatatatggtgattattta
ccgagagaagagtggtttgatttgaacccccatggtgagcttcttcttaggattgaaatg
gaaggtgaaagagaacacattggtttttatgttggacgaacttatcacgaccttgagcgt
gctcagagagagatgattaaatttattgttaataagatggagcccgttattaatcaaaat
ctatcaacagcaacgctaaaaaagcttctttctgccaatacgtggatggatctcgacaaa
acaatgacctctgtaactagcctacttaatcgaactggattcagctctaaatcgtccgaa
aatgttaaaaaagaaggcgagcttaccgatgttcagattgaggctgctatttacgagctg
cttgattacttcgacttaaatttttccattatcgcgaagcacttaacaaaggacgtattc
gtaactgtaatgtcctatgtatgggacgaagttgtttgcactaccgaggaattgttgtta
ccacctgtttctgttaagccaattaatcgaaaaccactttctccagcccaaatggcaatt
gtgtacagatggctgcagtttttaaaagactatttttatgccaacggggaaggagtaaag
ttgcccgttttagaaacggaccattacaaggagctacttcgagtgcaggaatattatgat
aagccaactgattttcttcttcaggaatgcgataaaattgcctcgcaactatacttgtcc
tctcgtatggttaacaatgagcccgttgaaagtctacctcgacattccagaatcaagttt
gcgaataaggaaatttatcgttctggaactatcagaaaagtgcatattcaaacgaatgaa
agcgagttggaaagaaacgagcgtattattctccgaattctgcgtatgcgcgctgattcg
aagagatttttatcaaagcatttccaaaggaaaggcagattactaatggctgatgctatg
agaaacggttatgtgatgccacttggtcatttaaaaaagctggattcccggtga

DBGET integrated database retrieval system