KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.03
Entry
SPAC11E3.03       CDS       T00076                                 

Gene name
pcs1
Definition
(RefSeq) chromosome segregation protein Pcs1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Csm1 DUF5094 MIC19_MIC25 Rota_NS26
Other DBs
NCBI-GeneID: 3361562
NCBI-ProteinID: NP_001018298
PomBase: SPAC11E3.03
UniProt: O13684
Position
I:join(5286130..5286181,5286221..5286562,5286609..5286821,5286877..5287055)
AA seq 261 aa
MRKNNMQTSKDSELKEQAKGKSSKLIHKLPKQRTRISQGQMHSTQDFVNNEDQDAYSVRE
NENELHINNSGMSELNKKLQLPNVELSTLSHTQEQEFNELNKLIRKINELQEFYLLEDLA
KPVTNAGADADDTIVKDLKKELENEKKANHSLKNELLKTREQIKNYSKINILIKELFGLE
VADCIEDEDGYRFNCKNTGRRGTLEYQLLLDDQNFTFTPRLNVQTDEELMKHLPDYLLEE
IIFTKEQGKLFSARLMKALQD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagaaaaaataatatgcaaacatctaaagatagtgaactaaaagaacaagctaaagga
aaatcgtccaagcttattcataaattaccaaaacagcgtacacgcatctctcaaggacaa
atgcattcaactcaggattttgttaataatgaagatcaagatgcatatagtgtaagggag
aacgaaaatgaacttcatatcaataattccgggatgtcagagttgaataagaagttgcaa
ctccctaacgtagagttatctactctttcgcacacccaagagcaggaattcaatgaactg
aacaagctgatacgaaaaattaatgaactacaagaattttatttacttgaagatttggca
aaacctgttaccaatgctggcgctgacgctgatgacacaatagtcaaagatttaaaaaaa
gaactagaaaatgaaaagaaagctaaccattcgttaaagaatgagttattgaaaactcga
gagcaaataaaaaactattcaaaaattaatatacttataaaggagcttttcggattagaa
gttgcagactgtatagaggacgaggatggatatcgtttcaactgtaaaaacactggaagg
agagggacactcgaatatcagctcttgttagatgatcaaaactttacatttactccacgt
ctgaatgttcaaactgatgaggagcttatgaaacatttaccagactatttgttggaggaa
attatctttacgaaagaacaaggaaaattattttctgctagattaatgaaagctttgcaa
gattaa

DBGET integrated database retrieval system