KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.08c
Entry
SPAC11E3.08c      CDS       T00076                                 

Gene name
nse6
Definition
(RefSeq) Smc5-6 complex non-SMC subunit Nse6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Nse5
Other DBs
NCBI-GeneID: 2541512
NCBI-ProteinID: NP_594933
PomBase: SPAC11E3.08c
UniProt: O13688
Position
I:complement(5296165..5297733)
AA seq 522 aa
MNASNNISKFPDLDNSSKLIDHILDSDDSEELDELPDISSLVPSARAQSRKQYLKNDSSN
SSTYRWNIDLLSSTATIDDSVAKRRKLAVQNLLQYDSTQTFQTGDEIDELIGKSVGSNVL
NVLRSNPIYDDDLRYEYCSNSKARVPDWNTLKAECLKDNDLEFNEGIIPTTFGDLLSAKL
VPLDIALSICSLQFFRSLGDTTCSEWIANLEKIFYSYKSSSNNLNQIVRFIFETTADMIG
IDLAKRQVPIQLERTSASENLKSNLKIKVINFLKCCGTLYRFSDDTVRFEMIQDACRILI
DNQVGSFCKWQFSQFMELPISLNPDFLISNIHKVSESPRVWVTILSSLSRSCQKFRKKIA
FTLFVGKQSKNDDSDFSSLCQRLDEISASCNNDYTTLLYQIRTFGYAVDEKHFKTNERLE
CLLEKLRKIDLTISGSTDHLLLSRCEVKDCIHRLFMVLYYLNTNSAPELERIIESDLPNN
NKQKDRYFKDKTSNLSMKENKSFSAKKVKKGKKKNKRQAYKR
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgaatgcgtctaataacatttcaaaatttcctgatttagataattcttcaaaattaatt
gaccacatacttgatagtgatgattctgaagagttggacgagcttcctgatatctcttct
ttggtgccttcggcaagagcccaatcgcgaaaacagtatttgaaaaatgattcttctaat
tcatctacatacagatggaatattgatcttctttctagtactgctacaattgacgattcg
gttgcaaaaagaagaaaattagcagtacaaaatttattgcaatatgacagcactcaaacc
tttcaaacgggagatgaaattgatgaattaataggaaaaagtgttggatcaaatgttttg
aatgttctacgttctaaccctatttatgatgacgaccttaggtacgaatattgtagcaat
tcaaaagctcgtgttccagactggaacaccctgaaagcagaatgcttgaaagataacgat
ttggagtttaatgaaggaattataccaacaacttttggtgatttattatcggcaaaattg
gtccccttagatattgcattgtcaatatgcagcttgcaatttttccgctctttaggagac
acaacatgctctgaatggattgctaacctagaaaagattttttatagctataaaagcagc
tctaataatctcaaccaaattgtacgatttatttttgagactactgcagatatgattggc
attgatttagcgaaacgacaggtaccaatccagttggaacgtacgtcagcctcagaaaat
ttaaaaagcaatttgaaaattaaggtaattaatttcctaaaatgctgtggaactttgtat
cggttctccgacgacactgttcgctttgaaatgattcaggatgcatgtcgaatcttaatt
gacaatcaagtgggctcattttgtaaatggcaattttctcaattcatggaacttccaata
tcattgaatccagattttttgatcagtaatattcataaggtgtctgaaagtcctagagtt
tgggttacaatactatcttctttgtctcgttcctgccaaaaattcagaaagaagattgct
tttacattatttgttgggaaacaaagtaaaaatgatgattcagacttttcttctttatgt
caacgactagatgaaatttccgcttcctgtaataatgactatacaactttattgtaccag
attcgtaccttcggatatgcggtggatgaaaagcattttaaaactaatgagcgcttagag
tgcttactggaaaaattacgaaaaatagatttaacaatatctggttcaacagaccatttg
ctactatcgagatgtgaagttaaagattgcatacatagactttttatggtgctttactat
ttaaatacaaactcagcaccagaattggagaggattattgaaagtgacttgcccaataat
aataaacaaaaggacaggtatttcaaggataaaacttctaacttatcgatgaaagaaaac
aaaagcttttcagctaaaaaggtgaagaagggaaaaaagaaaaataaacggcaagcgtac
aaaagataa

DBGET integrated database retrieval system