KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.12
Entry
SPAC11E3.12       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00190  Oxidative phosphorylation
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPAC11E3.12
Enzymes [BR:spo01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     SPAC11E3.12
SSDB
Motif
Pfam: 2Fe-2S_thioredx LacI
Other DBs
NCBI-GeneID: 2542955
NCBI-ProteinID: NP_001342840
PomBase: SPAC11E3.12
Position
I:join(5305838..5306043,5306103..5306265,5306315..5306434)
AA seq 162 aa
MKPIRFFKPENLQLAKAILARYPLRFQSAALVPLLDLAQRQHGTWIPPTAMYEIASLAGV
SIDYVHSLILAYPNDFFWRPKKPRVRICNSWMCQQAAEEQGNSNWDSQCRSVATKYGFDV
ENTGCLGNCFQGPAMWINDKIYGVNTKEKLVDIMEALTQKKN
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaaccaatacgtttttttaaaccagagaatcttcagcttgcaaaggctatacttgct
agatatcctctacgcttccaaagtgctgctttggtaccattattagatcttgcgcaacga
cagcatgggacttggattcctccgacagcaatgtatgaaattgcttctctagcaggcgta
tcaattgattatgtgcattcgttaattttggcataccctaatgattttttctggaggcct
aaaaaaccgcgtgttcgtatttgcaattcttggatgtgccaacaagctgctgaggagcaa
ggcaattccaattgggatagccaatgtcggtctgtagcgaccaaatatggctttgatgtc
gagaatacggggtgtttgggaaactgttttcaaggaccagctatgtggattaatgacaag
atttatggagtgaatactaaggaaaagttagtagacataatggaagcattgacccaaaag
aaaaattag

DBGET integrated database retrieval system