KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11G7.04Help
Entry
SPAC11G7.04       CDS       T00076                                 

Gene name
ubi1
Definition
(RefSeq) ubiquitin-60S ribosomal protein L40 fusion protein
  KO
K02927  large subunit ribosomal protein L40e
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03010  Ribosome
Module
spo_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPAC11G7.04 (ubi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spo03011]
    SPAC11G7.04 (ubi1)
Ribosome [BR:spo03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    SPAC11G7.04 (ubi1)
  Archaea
    SPAC11G7.04 (ubi1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Ubiquitin_5 TBK1_ULD Rad60-SLD_2 DUF2407 Sde2_N_Ubi
Motif
Other DBs
NCBI-GeneID: 2541768
NCBI-ProteinID: NP_594398
PomBase: SPAC11G7.04 SPAC1805.12c SPBC337.08c
UniProt: P0CH06 P0CH07
Structure
PDB: 

Position
I:3969009..3969395
Genome map
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYARLPPRATNCRKKKCGHTNQ
LRPKKKLK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcgtcaagactttgaccggaaagactatcacccttgaggtggagtcctct
gacactattgacaatgtcaagagcaaaatccaagacaaggaaggaattcctcctgaccaa
caacgtcttatcttcgctggaaagcaattagaggatggccgtactctttctgactacaac
attcaaaaggagtctacccttcatttagttctccgtcttcgtggtggtatcattgagccc
tctctaaaggctttggcttccaaatacaactgcgaaaagcaaatctgccgtaagtgctat
gcccgtcttcctccccgtgctaccaactgccgcaagaagaagtgtggtcacaccaaccaa
cttcgtcccaagaagaagctcaaatag

DBGET integrated database retrieval system