KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11H11.05c
Entry
SPAC11H11.05c     CDS       T00076                                 

Gene name
fta6
Definition
(RefSeq) Sim4 and Mal2-associated protein 6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Fe_dep_repress
Other DBs
NCBI-GeneID: 2542646
NCBI-ProteinID: NP_594723
PomBase: SPAC11H11.05c
UniProt: Q9UTP3
Position
I:complement(join(4782047..4782195,4782243..4782273))
AA seq 59 aa
MEDKYILLSAVETFKSRLEELLMQSAKVQKQTMLRKELASSMNDMASTVQEALNKKKSS
NT seq 180 nt   +upstreamnt  +downstreamnt
atggaggataaatacattttattgtcagcagtggaaacgtttaaatcacgtctggaagaa
ctgctaatgcaatcggccaaagtacaaaagcaaacgatgcttagaaaggaattagcttct
tcgatgaatgatatggcttctacggtacaagaagctttaaataaaaaaaaaagttcgtaa

DBGET integrated database retrieval system