KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11H11.06
Entry
SPAC11H11.06      CDS       T00076                                 
Symbol
arp2
Name
(RefSeq) ARP2/3 actin-organizing complex subunit Arp2
  KO
K17260  actin-related protein 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04138  Autophagy - yeast
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPAC11H11.06 (arp2)
   04138 Autophagy - yeast
    SPAC11H11.06 (arp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC11H11.06 (arp2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPAC11H11.06 (arp2)
   04147 Exosome [BR:spo04147]
    SPAC11H11.06 (arp2)
Membrane trafficking [BR:spo04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    SPAC11H11.06 (arp2)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     SPAC11H11.06 (arp2)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC11H11.06 (arp2)
  Exosomal proteins of other body fluids (saliva and urine)
   SPAC11H11.06 (arp2)
  Exosomal proteins of bladder cancer cells
   SPAC11H11.06 (arp2)
SSDB
Motif
Pfam: Actin MreB_Mbl
Other DBs
NCBI-GeneID: 5802965
NCBI-ProteinID: NP_001342919
PomBase: SPAC11H11.06
Position
I:join(4783055..4783102,4783153..4784277)
AA seq 390 aa
MESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEA
VRSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMC
ETMFERYGFGGVYVAIQAVLSLYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLVGRLDV
AGRDATRYLISLLLRKGYAFNRTADFETVREMKEKLCYVSYDLELDHKLSEETTVLMRNY
TLPDGRVIKVGSERYECPECLFQPHLVGSEQPGLSEFIFDTIQAADVDIRKYLYRAIVLS
GGSSMYAGLPSRLEKEIKQLWFERVLHGDPARLPNFKVKIEDAPRRRHAVFIGGAVLADI
MAQNDHMWVSKAEWEEYGVRALDKLGPRTT
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggagtctgctcccattgttctagataatggaactggttttgtgaaggtcggatatgct
aaagacaattttccgcgctttcaattcccatccatcgtaggaaggcccattttacgtgct
gaagagaaaacaggaaatgttcaaattaaagatgttatggtcggtgatgaagctgaggcg
gtgagatctttacttcaagtaaaatatcccatggaaaatggcattatccgtgattttgaa
gagatgaatcaactttgggattacactttctttgaaaaactaaaaattgatccgaggggt
aggaaaattttgttgaccgagccccctatgaatcctgttgctaaccgcgaaaaaatgtgt
gagacaatgtttgaacggtatggttttggtggtgtttatgtcgccattcaggccgttctc
tctttatacgcacagggattaagcagtggtgtagttgttgattctggtgacggtgtaacc
catattgtgcctgtctatgaaagtgttgttttaaatcatttagttggtcgccttgacgtt
gccggtagggatgctacccgctatttgattagcttacttcttcgtaagggttatgctttc
aatcgtacagcagactttgaaactgttcgcgagatgaaagaaaaactttgttacgttagt
tatgatttggaattggaccataagcttagcgaagaaactaccgttttaatgcgtaattac
acccttcctgatggaagagttattaaagttggttctgagcgttatgaatgtccagaatgt
ctatttcaacctcatctggttggtagtgaacaaccaggtttgagtgaatttatttttgac
actatccaagcagctgatgtggacattcgcaagtatttgtatcgcgccattgttctctca
ggtggtagcagtatgtatgccggtcttccttcacgtcttgaaaaggaaataaaacagtta
tggtttgagcgtgttcttcatggagatcccgcacgtttgcctaactttaaggttaagatt
gaagacgctcctcgtcgccgtcatgccgtgtttatcggcggcgccgtattggcagatatc
atggctcaaaacgatcacatgtgggtgtccaaggcagaatgggaggagtatggagtacgt
gcactagacaaattgggtcctagaactacttag

DBGET integrated database retrieval system