KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1296.05c
Entry
SPAC1296.05c      CDS       T00076                                 
Name
(RefSeq) putative cyclin L family cyclin
  KO
K23966  cyclin L
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC1296.05c
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SPAC1296.05c
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 2542980
NCBI-ProteinID: NP_593045
PomBase: SPAC1296.05c
Ensembl: SPAC1296.05c
UniProt: O94612
Position
I:complement(716874..718168)
AA seq 258 aa
MADSLVHSLASSSQLEAFDSFEYAEELCTLGSEWIQEAGVLLNLTQNCVIVCLILFRRYC
TLYPPRVPDLDAIVMACVSIGSKTTETPASVQDICNVVVYLKERFKDTNFEARGFIAHDL
YSEEMYSSRNRLSNMELEVLRALNFDTHIVIPHKLAIHYLQTLQLIDNKKLLQITWNFLN
DASRTRLCVLYPPFSLACGCIAMAARVIGMKLPKDWYRVFDTTKEEIDSLTSILENFYKT
SAIAHKTLYLIFTEQVSA
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcagattctttggtacattcccttgcctcttcttcccagttagaagcctttgattct
tttgaatatgcagaggaactatgtacattaggttctgaatggattcaggaagcaggcgtt
cttttgaatctaactcaaaattgtgtaattgtttgtttgattttgtttcgaagatactgc
acactttatccgccgagagttcccgatcttgatgctatcgttatggcttgtgtgtccatt
ggaagtaaaactaccgaaactccagcttctgtacaagacatatgtaatgttgtagtctat
cttaaagagcgtttcaaggacacgaattttgaagcacgaggattcattgctcacgatttg
tacagtgaggagatgtatagttccaggaatagattatcaaacatggaattggaggtctta
cgagcattgaattttgatacccatattgtcattcctcacaagctggcaattcattatcta
caaacattacagctaattgataacaaaaagcttttacaaataacatggaattttttaaac
gatgctagccgaactcgactttgcgttttgtatcctccgtttagtttggcatgcggctgc
atcgcaatggcagctagagttatcggtatgaaattacccaaagactggtatcgagtcttt
gatactacaaaagaagaaatcgattctttaacaagcattttggaaaatttttataaaaca
agcgctattgctcataaaacattgtatctcatttttactgagcaagtttctgcttaa

DBGET integrated database retrieval system