KEGG   Schizosaccharomyces pombe (fission yeast): SPAC12B10.12c
Entry
SPAC12B10.12c     CDS       T00076                                 
Symbol
rhp41
Name
(RefSeq) DNA repair protein Rhp41
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPAC12B10.12c (rhp41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC12B10.12c (rhp41)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      SPAC12B10.12c (rhp41)
SSDB
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2 Transglut_core
Other DBs
NCBI-GeneID: 2542967
NCBI-ProteinID: NP_594644
PomBase: SPAC12B10.12c
Ensembl: SPAC12B10.12c
UniProt: Q10445
Position
I:complement(4593600..4596120)
AA seq 638 aa
MMSDEDNTYSDDEEWLDLDLGLPNNDIKTAPILNSSLLSSAVHGERLIQERPTHDFGDVE
ATVDRTVEKRSRLKITSVDRKIRLQIHQLHLLCLTYHLCTRNTWCDDNRLNYLVKYIPPG
IRVSLHPSSQKSQMIRNKTFLHGLAGLVEVWKRKYKITTNGLRKPNYGLLQNNSLISESL
SLEEFCKNSKLLSGSRDYGTQLFASILRNLNVPTRLVFSLQVLSFRFKGAINEASSHEIV
PAWSQQMENDSSSDISESAHITSRFRKRRKIIQPSFSNLSHLDASDIVTEDTKLKVIDSP
KPVFWVEAFNKAMQKWVCVDPFGDASVIGKYRRFEPASSDHLNQMTYVFAIEANGYVKDV
TRKYCLHYYKILKNRVEIFPFGKAWMNRIFSKIGKPRDFYNDMDAIEDAELLRLEQSEGI
PRNIQDLKDHPLFVLERHLKKNQAIKTGKSCGRINTKNGVELVYPRKYVSNGFSAEHWYR
KGRIIKPGAQPLKHVKNGDKVLPLYDEEATQLYTPKPVVANIVPKNAYGNIDLYVPSMLP
YGAYHCRKRCALAAAKFLEIDYAKAVVGFDFQRKYSKPKLEGVVVSKRYEEAIDLIAEEI
DQEEKEAEARNVRKTCLLLWKRLITGLRIRQRVFEEYG
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgatgagtgacgaagataatacctatagtgatgatgaagaatggttagatttagatctt
ggtctccctaataatgatattaaaactgcacctattttaaattcttcgctcctttcatcc
gccgtacatggtgaaaggttgattcaagaacgaccaactcatgattttggagacgttgag
gccaccgttgatcgaacggttgaaaaacgtagccgcttaaagatcacttccgttgataga
aagattcgtcttcaaattcatcagttacacttactctgtttgacttatcatctttgcaca
cgaaacacttggtgcgatgacaatagactaaattatcttgtgaaatatattcctcctggt
atacgtgtctcgcttcatccctcttctcaaaagtcacaaatgattcggaacaaaactttc
ctacacgggttggctggactcgtcgaagtttggaaacggaaatataaaatcactaccaat
ggattaagaaaaccgaattatggtttactacaaaacaatagcctcatctctgaatcttta
tcccttgaggagttttgtaaaaactcaaaattgctttccggtagtagagattatggaacc
cagttatttgcatctattcttcgtaatttaaacgttccaactagactagttttttcacta
caagttttatcttttcgatttaaaggtgccataaatgaagcaagtagtcatgaaattgtt
ccggcatggtctcagcaaatggaaaatgattcatctagcgatatctctgaaagtgcacac
attacttctagatttcgcaaacgtaggaaaatcatacagccttctttttcaaatctttca
catcttgatgcctcagatattgttacagaagatacaaaactaaaggtaattgattctccc
aaaccggttttttgggtagaggcttttaataaagctatgcaaaaatgggtttgtgttgat
ccatttggtgatgctagtgtcattggcaagtacagaaggtttgaaccggcttccagtgac
catctaaatcaaatgacttatgtatttgctattgaggctaatgggtatgtaaaagatgtt
acccgaaaatattgtttacattattataaaatattaaagaatagagtcgagatttttccc
tttggaaaggcttggatgaatagaatattttctaaaattggaaaaccaagggatttttat
aatgacatggatgctatagaggatgcggaattactaaggcttgaacaatcagaaggaatt
ccgaggaatattcaagatttgaaagatcacccgctttttgttttggagaggcatttaaaa
aagaaccaggctattaaaactggtaaatcctgtggaagaatcaacacaaaaaatggggtc
gaattagtgtatccacgcaaatatgttagcaacggcttctctgctgaacattggtatcgt
aagggtcgtatcataaagccaggagctcagcctttaaaacatgttaagaatggagataaa
gtattacccttgtatgatgaagaagctacgcagttgtacactccgaaaccggttgttgcg
aacattgttcctaaaaatgcatacggaaacatcgatttatatgtcccttcaatgttgcca
tatggagcatatcattgtagaaaacgttgtgctttggcagcagctaaatttttagagatt
gactatgcaaaagcagttgttggatttgattttcaacggaagtactcaaagcctaaatta
gagggagttgttgtttctaagcgttatgaagaggctatcgatctcattgcagaggagata
gaccaggaagaaaaagaagcagaggcaaggaatgtaagaaagacttgtcttttattatgg
aagcgactgattacaggccttcggattcgtcagcgtgtattcgaagaatacggttaa

DBGET integrated database retrieval system