KEGG   Schizosaccharomyces pombe (fission yeast): SPAC12B10.16c
Entry
SPAC12B10.16c     CDS       T00076                                 
Symbol
mug157
Name
(RefSeq) protein mug157
  KO
K09704  uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPAC12B10.16c (mug157)
SSDB
Motif
Pfam: Glyco_hydro_125
Other DBs
NCBI-GeneID: 2543213
NCBI-ProteinID: NP_594648
PomBase: SPAC12B10.16c
Ensembl: SPAC12B10.16c
UniProt: Q10449
Position
I:complement(4601278..4603478)
AA seq 509 aa
MKYWQAILFFLFGIAFANNLNIPWKACPNYKTYSGRRHYPATGPLRLPFQRPATSCRTFH
SKSVEQTIEDVKEQLEDEDLARLFENCMPNTLDTTIRWHAADSHNPQTLVITGDIPAEWI
RDSANQLLPYLPLAKSDSPLATLILGAIQTQAEMLIQFPYCNAFQPPKQSFLSGNDNGQS
DRVTPAYDPAVVFECKYELDSLASFLKLSYTYWLYTKDQSIFTVKWLAAVERIIQVLEEQ
SSPSFDEKTGLPKDPVYTFLRNTDSGTETLGLAGRGFPLNANASLIRSAFRPSDDACVLQ
YFIPANAMMVVELSHLNQMLQASGHADIARTALVWANKIQKGIDQHGIVDHPKFGKVYAY
EVDGYGSILFMDDANVPSLLSLPYLGFVERDDPVYVNTRKMILSSEGNPYYLKGKVISGI
GGPHIGLRNVWPMSLIVQALTSDDDDEIMSLLDVLKHSTAGLGLMHESVDVSSFKSFTRP
WFSWANSLFAELILDLLERKPHLLKKNAS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaaatattggcaggcaattctatttttcctatttggaatcgctttcgcgaacaatctt
aatattccttggaaggcatgtcctaattacaagacatactctggaaggagacattatcca
gctactggccctttgaggttaccgtttcaacgaccagcaacatcatgccgtacgtttcat
tctaaatcggtggagcagactattgaagatgtgaaggagcaacttgaggatgaagattta
gcacgtttatttgaaaattgtatgccaaatactcttgatactacaattcgttggcatgcc
gctgattcacataatcctcaaaccctagtaatcactggtgatattcctgccgaatggatc
agagattctgcaaaccagcttttgccttacttacctctagctaaatcagactcaccatta
gcgacgttgattcttggtgccatacaaacgcaagctgaaatgttaatccagtttccttat
tgtaacgcttttcagcctcctaaacaaagctttctttcaggaaacgacaatggacaaagt
gatcgtgtcacaccagcttacgatccagcagttgtatttgagtgtaaatatgaattagat
tccttggcttcatttttaaagctctcctacacttattggctttatacgaaggatcaatct
atttttactgtgaaatggcttgcggctgttgaacgcataattcaagttttagaagagcag
tcttctccatcatttgacgaaaagaccggtttgcctaaggacccagtatatactttcctc
cgaaataccgattctggtactgaaactcttggccttgctggaagaggttttccccttaac
gctaatgcatctttaatacgcagtgcttttcgtccatctgatgatgcctgtgttttacaa
tactttattcctgctaatgccatgatggttgtggaactttcacatcttaatcaaatgttg
caagcatcaggtcatgcagacattgctagaactgctctcgtttgggccaacaaaatccaa
aagggtattgaccagcacggcattgtcgaccatccgaaatttggcaaggtatatgcgtat
gaagtagatggttatggcagcattttatttatggatgacgccaatgttccttctctattg
tctttaccttatcttggatttgtagaacgtgatgaccctgtatatgttaatacgaggaag
atgattttatcttcagaaggaaatccttactaccttaagggaaaagttatctccggtatt
ggtggtcctcacattggtttgaggaacgtttggcccatgagtctcattgttcaagccctg
acttctgatgacgacgatgaaatcatgtctttgcttgatgttttaaagcattcaactgct
ggtttaggcttaatgcatgagtctgttgatgtttcgagttttaaaagctttactcgaccc
tggttttcatgggctaattcattatttgccgagttgattttagatttacttgaacgcaag
cctcacttgttaaagaagaatgcatcatga

DBGET integrated database retrieval system