KEGG   Schizosaccharomyces pombe (fission yeast): SPAC139.04c
Entry
SPAC139.04c       CDS       T00076                                 

Gene name
fap2
Definition
(RefSeq) L-saccharopine oxidase
  KO
K17833  L-saccharopine oxidase [EC:1.5.3.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPAC139.04c (fap2)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.18  L-saccharopine oxidase
     SPAC139.04c (fap2)
SSDB
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox_3 TrkA_N GIDA NAD_binding_8 Sacchrp_dh_NADP Amino_oxidase
Other DBs
NCBI-GeneID: 2541766
NCBI-ProteinID: NP_593171
PomBase: SPAC139.04c
UniProt: Q9UTM9
Position
I:complement(1024176..1025477)
AA seq 433 aa
MSRTIVIVGCGVFGLSTAVELAKNHSFDNIIAIDAEPVPSSMSAANDINKIVRPEYADLK
YMKLALEAMEKWRNDPELSSVYFECGRLSTISKDPYRARFDEVAQRNLRKLLGDSALINL
SSSEEIRKKYPSLFSNSPLRSDMQAVVNEHAGYANSAASLKLLELKARELGVEFVFGKAG
KFKKFVVNHSETDIDKNDNHVSVQTEDGTIYHADTILLAVGAYLNAYLNTSHRVCAKGLP
VAHIQLTDEEFKTYKNMPIIFDPDCAYAFPPYPVTKLIKLASTGYEYVCNVETDYDENSK
VVSIPHSGPSKSSLPKYAIIQMRRFLDTFLPDLADRSLINTKMCWISDTEDANFLIDKVP
QFDNVFVANGDSGHAFKFLPNIGRYIAQRILGDLSEEWKDAWRWREDDKASELKWRCVRS
LIDYKDAEFTYDK
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcgagaaccattgtcatagttggatgtggagtttttggcctttcaactgcagttgaa
ttggcaaaaaatcattcctttgataatatcattgctattgatgccgaacccgttccttcc
agcatgtctgcagcaaacgatatcaacaagattgttcggccagaatatgcagatcttaag
tatatgaaattggcgttggaagcaatggaaaaatggagaaatgacccagaattgtcctct
gtttatttcgaatgcggccgcttaagcaccatttccaaagacccatacagagctcgtttc
gatgaggtagcccaacgaaacttgagaaagcttttaggagactctgctcttattaatctt
tccagttcagaagaaataagaaaaaaatatccttcacttttttctaattcaccgctgcgc
tcagacatgcaagctgtcgtaaatgaacacgctggttatgcgaattcagctgcttctcta
aaattacttgagttaaaggctagggagctaggagttgagtttgtttttggtaaagccggt
aaattcaaaaaatttgtggtcaatcattccgaaactgatattgataaaaacgacaatcat
gtatcagtacaaacagaggacggtactatatatcatgctgatactattttactagctgtt
ggtgcttatttgaacgcttatttaaatacttctcatcgtgtctgtgctaagggtttaccg
gtcgcgcatattcagctaaccgatgaagaatttaagacttacaaaaatatgcctattatt
tttgatccagattgcgcttatgctttccctccttatcctgtgacaaagctcataaaattg
gccagcaccggatatgaatacgtatgtaacgttgagaccgactacgacgaaaactcaaaa
gttgtttccattcctcattccggaccatctaaaagtagtctaccaaaatatgccattatt
caaatgcgccgtttccttgacacctttttgcctgatcttgcagaccgcagcctgataaac
acgaagatgtgttggatttctgacaccgaagatgcaaacttccttattgacaaggtccct
caatttgataacgtttttgtcgcaaacggagatagcggacatgctttcaaatttcttccc
aatattggcagatacatagcacaacgtattttaggggatttatctgaagaatggaaagat
gcatggcgttggagagaggatgataaagcttcagaactgaaatggagatgtgttcgctct
ttgatagattacaaggatgcagagtttacttacgacaagtga

DBGET integrated database retrieval system