KEGG   Schizosaccharomyces pombe (fission yeast): SPAC139.06
Entry
SPAC139.06        CDS       T00076                                 

Gene name
hat1
Definition
(RefSeq) histone acetyltransferase Hat1
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC139.06 (hat1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPAC139.06 (hat1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    SPAC139.06 (hat1)
   HAT complexes
    HATB complex
     SPAC139.06 (hat1)
SSDB
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 2542502
NCBI-ProteinID: NP_593173
PomBase: SPAC139.06
UniProt: Q9UTM7
Position
I:join(1030230..1030287,1030338..1030441,1030503..1030721,1030811..1030926,1030998..1031361,1031418..1031693)
AA seq 378 aa
MSAVDEWVHNANECIEIVQVNEKHEKDCQYHPSNTYAIFGDAEVIYGYKDLNVTITYECP
LMVPKLEISYSERLAPDSGVEPTDIEGTLNTYLKDRSIKVEGNSFDVHSANSIHNYSFNG
KTFKILQATVLEASEIMQHLQIFSLFFIEGGSFIDLNDPRWMVYLLYETTEDDYCLRGYC
TVYKYYKWDKLIHDGIRARISQFVILPPFQHQGHGSQLYNAIVSTFLKNPKILDFTVEDA
SEAFDSLRDHCDYKRLLSMGIFSEPDFHPSLSRQWINSKIAETKLTQRQFSRCCELAFTT
KLKKLSLLERKSVRLGIKERIFRQNLDVLLQLDKSERIEKIHNAYENQFDEYKQIVKKLP
KLKEDSPRKRQKLAQSSS
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagtgctgttgatgaatgggtacataatgccaatgaatgcatagaaattgtacaagta
aacgaaaagcatgaaaaagattgtcaataccatcctagcaatacatatgcaatatttgga
gatgctgaggttatttatggatataaagatctaaatgtcactataacctatgaatgccca
ttgatggtcccaaaactggaaatctcatattcagagcgcctagcaccagattcaggagtg
gaaccaactgatattgaaggaacattaaacacttatctaaaagatcgttccattaaggtt
gaaggaaactcatttgacgttcattcggcaaatagtattcataactattcctttaatgga
aaaacattcaagattttacaagcaacggttcttgaagctagtgagattatgcagcatttg
caaatattttccttattttttattgaagggggctcttttattgaccttaatgatccaaga
tggatggtatatttactttacgagactactgaagatgattattgcttacgtggttattgt
actgtatacaaatattataaatgggacaaattaattcacgatggtattcgagctcgtatc
tcacaattcgtgattttacccccttttcaacatcaaggacacggttcgcaattgtacaat
gctattgttagtacctttttgaaaaatcctaaaattttagacttcacagttgaggatgca
tcggaagcgtttgatagccttagagaccattgcgactataaaagattattatcaatggga
atattttcagaacctgactttcatccctctctttctaggcagtggataaactcgaaaata
gctgaaacaaagttaacccagcgtcaattctcacgctgttgtgaattagcatttacaacg
aaactaaaaaagctttcattattggagcggaaatctgttagactaggaataaaggaaagg
atttttcgtcaaaatcttgatgtgttgctacagttggataagtccgaacgtattgaaaaa
attcataacgcctatgaaaatcagtttgatgagtataaacagattgtcaaaaagctaccc
aagcttaaggaagattcgcctcgaaaacgccaaaaacttgctcaatcttcttcctaa

DBGET integrated database retrieval system