KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1399.03
Entry
SPAC1399.03       CDS       T00076                                 

Gene name
fur4
Definition
(RefSeq) uracil permease
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SPAC1399.03 (fur4)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-GeneID: 2542586
NCBI-ProteinID: NP_593511
PomBase: SPAC1399.03
UniProt: Q10279
Position
I:complement(1841936..1843681)
AA seq 581 aa
MESVDNNSFFSRIRNSNAYRKVKDFVILDHRPGMTMAERMLTNKDLYPVPPSKRLWGPWN
FISFWLADAVNINTWMISATAIELGLNWWEAWICVWVGYLICGILVATTGRPGAVYHISF
PVLSRSSFGTWGSLWPILNRSVLACVWYGVQAWIGGECVVLMIRSIWPSFSHIPNTMAKS
GTETYQWVGFFIFWLLSNIAIWFPVHQIRHLFTFKAIVAPPAAIAFLIWALVKAHGAGPV
IHEPTKLGQYEHAWVVINGIVTCIDGFATLIVNNPDFARFATTPGAVHWPQIITVPLAFG
VTSLIGVLVSSASKAIYGTTLWDPTQLLASFLDHSNAHGVRAGVFFIAFGLCIAQLGVNI
AANSVSAGNDLSALLPTVINVRRGGYIASIIALCMCPWNLLSSNNNFTTYLSSYSVFLSS
FAGVIIADYYFVRKGLIRVAPLYSSSSSSPYYFWKGINFRAFASYICGMLINIVGMAGST
GQKVPKVANTMFNLNYFLGITVACLSHIIICKIFPVTECGEKMLSEVPEEADDYLLTLAS
EDSIDKDSTSEIYIDGLPTEKEVEKDDVLSITSKKLSGCFP
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggagtctgtggataataattcttttttttcacgaattagaaatagcaatgcctataga
aaggtcaaggattttgttatattggatcataggcctggtatgactatggccgagagaatg
ttgactaacaaggatctatatcctgttcctccttccaagcgcctttgggggccttggaac
ttcatttctttttggttagctgatgctgtcaacatcaacacttggatgatttctgccacc
gctatcgagcttggcttgaactggtgggaggcatggatttgcgtttgggttggctatctt
atttgcggtattttagttgcaactactggtcgccctggtgcagtatatcacatttcattc
cctgttctttctcgttcttcctttggtacatggggttcattatggcctattcttaatcgt
agtgtcctggcatgcgtctggtacggtgtgcaggcttggattggtggtgaatgtgttgtt
ttgatgattcgctcaatttggccttctttctcccatatccctaacaccatggcaaaaagt
ggtacggagacataccaatgggttggcttttttatcttttggctcctttcaaatattgcc
atttggtttccagtacatcaaattcgtcacctcttcacttttaaggccattgtcgctcct
cctgcagccattgctttcctaatttgggcgctcgttaaagcccacggcgccggtcctgtt
attcatgaacctacaaaattaggtcagtatgaacatgcttgggtggtaattaatggaatt
gtaacctgtattgatggctttgcgactcttattgtcaataatcctgattttgcacgcttt
gcgaccacccctggcgccgtacactggcctcaaatcatcaccgttccccttgcctttggt
gtaacttcgctaatcggtgttcttgttagttctgcatccaaagccatttatggcacgact
ctttgggatcctactcaattgcttgcctctttcctcgatcactctaacgcccacggtgtt
cgtgccggtgtctttttcatcgcatttggtttgtgtatcgctcaactcggtgtcaacatt
gctgctaattcggtttctgcgggtaacgatttgtcagctctcttgcctactgtaattaat
gttcgtcgtggtggttacatcgcctctattattgccctctgcatgtgcccatggaattta
ttaagctcaaacaataacttcacaacttatttatcctcatactccgtctttttgtcttca
tttgctggcgttatcattgccgactactatttcgtgcgcaaaggcttgattagagttgct
cctttatactcttcctcttctagcagcccctattacttttggaagggtatcaacttccgg
gcatttgcttcttacatttgtggtatgcttatcaatattgttggtatggctggttcaact
ggacaaaaagtcccaaaagttgctaataccatgtttaatttaaattactttttgggtatt
accgtcgcctgtttatctcatataatcatttgcaaaatcttccctgttaccgaatgcggt
gagaaaatgctttctgaggttcccgaagaagctgatgactatttgcttacccttgcctca
gaagactccatcgacaaggacagtacatctgaaatttatattgatggacttcccactgag
aaggaggttgagaaggacgacgttctcagtattacgagcaaaaaattatcgggttgtttt
ccttag

DBGET integrated database retrieval system