KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13F5.03cHelp
Entry
SPAC13F5.03c      CDS       T00076                                 

Gene name
gld1
Definition
(RefSeq) glycerol dehydrogenase Gld1
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00561  Glycerolipid metabolism
spo00640  Propanoate metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SPAC13F5.03c (gld1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPAC13F5.03c (gld1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SPAC13F5.03c (gld1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PLDc_3
Motif
Other DBs
NCBI-GeneID: 2542881
NCBI-ProteinID: NP_593651
PomBase: SPAC13F5.03c
UniProt: O13702
Structure
PDB: 

Position
I:complement(2175008..2176360)
Genome map
AA seq 450 aa AA seqDB search
MIGPRLCAATPRFPLVSLAHRNSKVFALASSNAVAQRWGKRFYAPIETETPHKVGVEFEE
SKDRIFTSPQKYVQGRHAFTRSYMYVKKWATKSAVVLADQNVWNICANKIVDSLSQNGMT
VTKLVFGGEASLVELDKLRKQCPDDTQVIIGVGGGKTMDSAKYIAHSMNLPSIICPTTAS
SDAATSSLSVIYTPDGQFQKYSFYPLNPNLIFIDTDVIVRAPVRFLISGIGDALSTWVET
ESVIRSNSTSFAGGVASIAGRYIARACKDTLEKYALSAILSNTRGVCTEAFENVVEANTL
MSGLGFENGGLAAAHAIHNGMTAIHGPVHRLMHGEKVAYGTLVQVVLEDWPLEDFNNLAS
FMAKCHLPITLEELGIPNVTDEELLMVGRATLRPDESIHNMSKKFNPSQIADAIKAVDSY
SQKWQEQTGWTERFRLPPSRHSPHLTDIHP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcctcgtctttgcgctgcaacccctcgcttccctctcgtttccctcgcccac
aggaactctaaagtatttgcgctcgcctcttccaatgccgttgcacaacgttggggcaaa
cgcttttatgctcctattgaaacggagacgcctcacaaagttggtgtagagtttgaagaa
tccaaagatcgcattttcacctctcctcaaaagtatgttcagggtcgtcatgccttcact
agatcctatatgtatgtcaaaaaatgggccactaaatcagctgtcgtgcttgccgaccag
aacgtatggaacatttgtgccaataaaattgtcgattctctttctcaaaacggaatgact
gtcaccaaactggtctttggcggcgaggcaagcttggtggaactggataaacttcgcaaa
cagtgccctgatgatactcaagtcatcattggagttggtggtggtaaaaccatggattcc
gcaaagtatattgctcattccatgaatcttccatccatcatttgtcctactactgcctcc
tctgatgccgctacttcctctctttccgtcatttacactcctgacggtcaattccaaaaa
tacagcttttacccccttaatcccaacctcattttcatcgataccgatgtgattgttcgc
gctcccgtccgcttccttattagtggcattggtgatgctttgtccacctgggtggaaact
gaatccgttattcgctcaaattccacttcctttgccggaggtgtggcctccattgctggc
cgttacattgcccgtgcttgcaaagacactcttgaaaagtatgccctgagcgctattctt
tccaacactcgcggtgtttgtaccgaggcatttgagaacgtggtcgaggccaacacattg
atgtctggtctaggctttgaaaacggtggtcttgctgctgctcatgccatccataacggt
atgaccgccatccacggtcccgttcatcgtttaatgcatggtgaaaaggttgcttacggt
accttagttcaagttgttttggaggattggccgttggaagacttcaataatcttgcttct
tttatggcaaaatgtcatcttcccattacccttgaggaacttggtattcccaacgtaacc
gatgaagagttattgatggtaggtagagctactttgcgacctgatgagagtattcacaac
atgtcaaagaagttcaatccatctcaaattgctgacgctattaaagccgttgactcctat
tcacaaaaatggcaagaacaaactggatggaccgagcgttttagattacccccttctcgt
catagtcctcacttgaccgacattcatccatag

DBGET integrated database retrieval system