KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G6.03
Entry
SPAC13G6.03       CDS       T00076                                 

Gene name
gpi7
Definition
(RefSeq) putative GPI anchor biosynthesis protein Gpi7
  KO
K05310  ethanolamine phosphate transferase 2 subunit G [EC:2.7.-.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    SPAC13G6.03 (gpi7)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     SPAC13G6.03 (gpi7)
SSDB
Motif
Pfam: PIGO_PIGG Phosphodiest Sulfatase
Other DBs
NCBI-GeneID: 2542835
NCBI-ProteinID: NP_592829
PomBase: SPAC13G6.03
UniProt: Q09782
Position
I:177292..179568
AA seq 758 aa
MRFAFFGIFWLQIFGSILFLLGFFPHKNDSTGKAMSNQFSPPAVIDQVVFVMVDALRADF
VFSKSHNMPFTQSLLYNSTHGIGFSAFARSPTVTMPRLKALTTGTIPGFLDVLLNIAESD
TGSSIEAQDSWVYQLNSFNKKIEFYGDDTWLKLFPSAFSKFEGTTSFFVSDYTEVDNNVT
RNFDHALPSSLSHSWDALILHYLGVDHIGHLYGPSSPLLNIKLLEIDTIISRIYKYLQEY
DEKTNTHSLIVLCGDHGMNEVGNHGGSSSGETTAALSLLFPSNELSHINKPILNMDDNPY
SILERVEQVDVVPTICLLLGIPIPKGNMGKVLSPVTELWKDTKTAKMAALSNLFQLSLLK
NPSLTTSELSTQFQDSDLNDIRLALENLQSQMVAQSSSYSLDRMLVAISILGACSILSLI
LFRNLYNYKELLAFAPFVVQNIIIVFSSSFIEEEHVIWYFAAVSLSLLQLLNPKTRLAGS
LQLFCLSIIKRWNQTGQKYSDLRDIVDDFIAPSTFMKTILCVTSAFMPAIRSPSPINFLS
SMFIAFYKLMPIISKHLNELPIIASFDYTFFVRIIWSLLLISFLSKPTFKQLRCQLSLFI
LLLTRLENMGLYLLYDIWQRTMPEEGTLASVMYYVAEQVAFFSLGNSNSLATVDLSQAYT
GLDSYNIFAVGILLFTSVFAGALWWCLHQPKRMMDRSVKTFWIMSSISLTFLCISCFIMR
HHLFVWSVFSPKLLYNASWASMYFLAKCLISTIMVRLR
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgaggtttgcattttttggtatcttctggcttcaaatttttggatcgatcctttttctt
ttaggattctttcctcacaaaaatgactctaccggcaaggcaatgtctaatcaattttct
ccgcctgctgtaattgatcaagttgtgttcgtgatggtcgatgctttgagagcagatttc
gttttttcaaagtcacataacatgccttttactcaatcccttctttataattctacccat
ggtattggattttctgcttttgctcgttcccctaccgttacaatgcccagactgaaagct
ttaaccaccggtactatacccggatttttggatgtgcttttgaatatcgcagaatcggat
actggttcaagcattgaggctcaggacagttgggtgtatcaactcaattccttcaataag
aagattgagttttatggagatgatacatggcttaaactttttccaagcgccttctcaaag
tttgaaggtacaacaagcttttttgtatcagattatactgaagtcgataacaatgttacc
agaaatttcgatcatgcccttccatcatctttatcgcattcttgggacgctttaatacta
cactacttgggtgtcgaccatattggtcatctttatggaccatcgagccctctgttgaat
atcaaacttttggaaattgataccattatttcaaggatatacaagtatttacaagaatat
gatgaaaaaacaaacactcattctttaatcgtactttgtggggaccatgggatgaacgaa
gtaggcaatcacggaggctcttccagtggagaaaccaccgctgcactttcccttcttttt
ccttcaaatgaactatcccatatcaataaacctattttgaacatggatgataacccttat
tcaattttggaaagagtagagcaagtagacgtagtgccaaccatttgtctattgctgggc
ataccaatcccaaaaggaaatatgggtaaagttttgtcaccggtaacggagctttggaag
gacacgaaaacagccaagatggctgctttatccaatcttttccaattgtctttactcaag
aatccttcattaacgactagcgaactaagtactcagtttcaggactctgacttaaacgat
atccgtcttgcattagagaatctacaatctcaaatggttgcgcaatcttcctcttattcc
cttgataggatgttggttgctatttcaatactcggagcctgtagcattttatctcttatc
ttattccgaaacctttacaattacaaagaattactagcatttgccccgtttgttgtgcaa
aatatcattattgtattctcaagcagttttattgaggaagaacatgtaatttggtatttt
gctgccgtttctttatcacttctgcaacttttgaatcctaaaacaaggttggctggttct
ttgcaactattttgtctatcaattataaaaagatggaatcagactggtcaaaaatattca
gatttacgtgatatagttgacgatttcatcgcacccagtaccttcatgaaaaccatcttg
tgtgttacgagtgcttttatgcctgctatacgaagtccttctccaataaactttctatca
tcaatgtttatagcattttacaagttgatgcctataatttctaaacatttaaatgagttg
cctattatcgcttcatttgactacacattttttgtaagaatcatctggagccttttgcta
ataagttttctctcgaaacctacttttaaacaattgcgatgccagctttctctattcatt
ctcctcttaactcgattagaaaacatgggtttgtatttactttatgatatatggcaacga
accatgccggaagaaggtaccttggcttcagttatgtattatgttgctgagcaggttgct
ttcttttctttaggaaattcgaactcccttgcaacagtcgatttatcgcaagcttatacc
gggcttgattcttataatatttttgctgttgggatcttgctttttacttcggtttttgca
ggagctttatggtggtgcttgcatcagccaaagagaatgatggaccgttcagttaaaaca
ttttggataatgtctagcatatcgctaacttttttgtgcatatcttgttttattatgagg
caccacctttttgtatggagtgttttttctccgaagcttctatataatgcttcttgggct
tccatgtattttctagccaaatgcttgatttcaaccatcatggtccgtttacgatga

DBGET integrated database retrieval system