KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G6.12cHelp
Entry
SPAC13G6.12c      CDS       T00076                                 

Gene name
chs1, SPAC24B11.01c
Definition
(RefSeq) chitin synthase I
  KO
K00698  chitin synthase [EC:2.4.1.16]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPAC13G6.12c (chs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spo01003]
    SPAC13G6.12c (chs1)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.16  chitin synthase
     SPAC13G6.12c (chs1)
Glycosyltransferases [BR:spo01003]
 Polysaccharide
  Structural polysaccharide
   SPAC13G6.12c (chs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chitin_synth_1 Chitin_synth_1N Chitin_synth_2 Glyco_trans_2_3 Glyco_tranf_2_3 MVP_shoulder
Motif
Other DBs
NCBI-GeneID: 2542858
NCBI-ProteinID: NP_592838
PomBase: SPAC13G6.12c
UniProt: P30597
Position
I:complement(join(196090..196174,196221..198715))
Genome map
AA seq 859 aa AA seqDB search
MRRWFKKTLPRPPDEEESAGLTNKDIVETNHLYPTITNLSLNSDTSSILFDKNKKPLKPK
IIIPDKEFDLDYYLKDETESIQSPFEGFTAQPNFSNFNKQGNTMNREANFQRTNEKIQRN
KSIKRVKLFHGNLILDCPIPKKLLVTLPQQTEREFAYMRYSAATCDPQDFSKSLFTLRQP
LFFQPRKTEICIAITMYNEDEVLFARTMHSVMKNISHLCTRKNSQVWGKDAWKKVVVCII
SDGRTKIHPRTLAYLAAIGVYQDGIAKNQVNDKEVKAHIYEYTTQLSIDPNLKFKGSDRG
IVPVQMIFCLKEKNQKKLNSHLWFFQAFCPILKPEVCILLDAGTRPGDQSIYHLWKSFDL
NPQVAGACGEIVVMKGKLGSGLINPLVATQNFEYKMSNILDKPVESVFGFISVLPGAFSA
YRFEALQNDSQGNGPLASYFKGELQNTGKSGIFEANMYLAEDRILCFELVSKKNEAWILH
YVKSAYADTDVPDRIPEFVLQRRRWLNGSFFAAAYAICHYYRFFRTSHTISRKFMLSIEF
IYQLATIVFGWFNIGNFFIIFYILTSSLASTSANFLPGEILFRIAIWIYASLLVTCFVLA
LGNRPHGSPNFYLSMVIMYSILMGYLLFCSGWIAYRAISDAIHNASSTSSSYTSALLNSN
VFINIVISLSSTYGMYLVVSIISFDPWHMFTSFVQYIFLSIMYTNVLNVYAFCNTHDVSW
GTKGDHFTNNDLGVARLLQKGADVEIAIPTNQSDIDAKYEDAVKLLASPSLEFNSPIINH
GEQEDFYKNFRTYVVLTWILSNLFLVGIVLSIPKINGISISNNETSAYLSFLLWSVVAFS
VFRFIGCIFYLFIRLCTGE
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggtggttcaaaaaaacgctaccacgccctcctgatgaggaggaatcagctgga
ttaacaaataaagatattgttgaaaccaatcacttatatcctacaatcaccaatttgtca
ttaaacagtgatacttcgtccattttatttgataaaaataaaaaacctctaaaaccgaaa
atcattattcctgataaagaatttgatctcgattattatttaaaagatgaaacggaaagt
attcaatctccatttgaaggttttactgctcaaccaaatttttcaaacttcaataagcaa
ggaaatactatgaaccgagaggcaaatttccaaagaacaaatgaaaaaattcaaagaaat
aaaagtattaaacgagttaaattatttcatggcaatctcatcctcgattgtccaattcct
aagaagttattggttacacttccacagcaaacagagcgagaatttgcttacatgcgctac
agtgctgctacatgtgatccacaagacttttcgaaaagcctattcactttaaggcagccc
ctattctttcagccgagaaaaactgaaatttgtattgctataactatgtacaatgaagat
gaagttctgttcgctcgtaccatgcatagtgtcatgaagaatatttcacatttatgtaca
agaaaaaattctcaagtttgggggaaggacgcttggaagaaagtcgttgtgtgtataatc
tctgacggtcgcaccaagatacatccaagaacacttgcttatttagctgcaatcggagtt
tatcaagacggaattgctaaaaatcaggtcaatgataaggaagtaaaagcacatatatac
gaatatactacacagctgtctattgaccctaatttaaagttcaaaggatctgatagaggt
attgttcctgttcagatgatattttgtttaaaggagaaaaatcaaaaaaaactaaactcc
catttgtggttttttcaagcgttttgcccaatcctaaagccagaggtgtgcattctttta
gatgctggaacacgtccgggggaccaatccatttatcatttatggaaatcatttgatttg
aatcctcaagttgctggcgcttgtggtgaaattgtcgttatgaaaggaaaattgggttcc
ggtttaataaatccattggtagctactcagaattttgaatataaaatgagcaatatactc
gacaaaccagtagaaagcgtgtttgggtttatcagcgtactaccaggagccttcagtgca
tacagatttgaagctttacagaatgattctcagggaaatggtcctttggctagttacttt
aaaggagaacttcaaaataccggaaaatcggggatttttgaagcaaatatgtatcttgca
gaagacagaatactgtgttttgagctagtttcaaaaaagaatgaagcatggatcttgcat
tatgtaaagtctgcatatgccgatacggatgttccagatcgaatcccagaattcgtgcta
cagcgaagaagatggcttaatgggagtttttttgctgccgcttatgctatctgtcactac
tacaggttttttaggacttcacatactatttcgcgaaaatttatgttatctattgagttt
atttaccaattggcaactatagtttttggttggtttaacattggaaacttcttcataatt
ttttatattttgacatccagcctcgcatcaacaagtgctaattttctacctggagaaatt
ctatttagaattgcaatttggatttacgcatctttattggtgacatgctttgtattagct
ttaggaaatcgacctcatggctcgccgaacttttatttatccatggtaataatgtactct
atattaatgggatatcttttgttttgctccggttggattgcttaccgtgctataagtgat
gctatacataacgcaagcagcacctcttcatcttatacttctgcattgttgaatagtaat
gtctttataaatattgtgatatcactctcttccacctatggaatgtatcttgtggtatcc
attatctcttttgatccatggcatatgttcacttcgtttgtgcaatacatttttctttca
ataatgtatacgaatgtattaaatgtttatgcgttttgcaacacacatgacgtttcttgg
ggtaccaaaggagatcactttaccaacaatgatctaggtgttgcaagactccttcaaaaa
ggagctgatgtagaaatagcaattcctacaaatcaatcagacattgatgcaaagtatgag
gatgctgttaaactgctggcatctccttcattagaattcaacagtcccatcattaatcac
ggagagcaagaggatttttacaaaaattttcgaacgtatgttgtgcttacctggattctc
tcaaacctatttttggtaggaattgttctaagtataccaaaaattaacgggatctctatt
tcaaacaatgaaacaagcgcttatttgtcgtttctactttggagcgtcgttgctttctcg
gtttttcggtttattggttgtattttttatttatttattagactttgtacgggagaataa

DBGET integrated database retrieval system