KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G6.14
Entry
SPAC13G6.14       CDS       T00076                                 

Gene name
aps1
Definition
(RefSeq) diadenosine 5',5'''-p1,p6-hexaphosphate hydrolase Aps1
  KO
K07766  diphosphoinositol-polyphosphate diphosphatase [EC:3.6.1.52]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPAC13G6.14 (aps1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.52  diphosphoinositol-polyphosphate diphosphatase
     SPAC13G6.14 (aps1)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 2542890
NCBI-ProteinID: NP_592840
PomBase: SPAC13G6.14
UniProt: Q09790
Position
I:200235..200867
AA seq 210 aa
MLENNGSVILMEPDHLRTAVNRSMTSREGRTKNRFNPITGARLAAGVVALSADKRKVLLV
SSAKKHPSWVVPKGGWEADESVQQAALREGWEEGGLVGHITRSLGSFKDKRPTDTIDRRK
KYLKQLMSKSSGNDVSTNTELGAEAEKLLLPPRAECEFFEVIVERLEDNYPEMRKRRRKW
MSYQEAKEALTSRKDILAALEKSSIIKEEN
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcttgaaaataacggaagtgtgattttaatggagccggatcatctacggacggcagtg
aaccgctcaatgacttctcgtgaaggtcgaacgaaaaatcgattcaatcctattacagga
gccagacttgctgcgggtgttgttgctttatctgcagacaaaaggaaagtcctattagtt
tcttctgctaaaaaacatccttcttgggtagttcctaagggtggatgggaggctgatgaa
tctgttcagcaagctgcccttcgtgaaggttgggaagaaggcggactagtgggtcatatc
actagatcccttgggtctttcaaggataagcgtcctactgatactattgacagaaggaaa
aaatatttgaagcaattaatgtcaaaaagtagcggaaatgacgtctcaaccaataccgag
ttaggagccgaagcagagaaattattacttccacctagagccgaatgtgaattttttgaa
gttattgttgaaagattagaagacaattacccagagatgaggaagcgtcgccgaaaatgg
atgtcttatcaagaagcaaaggaagcgttgacaagtcgtaaagatattttggcagctctt
gagaagagctctatcattaaagaggaaaactga

DBGET integrated database retrieval system