KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G6.15c
Entry
SPAC13G6.15c      CDS       T00076                                 

Definition
(RefSeq) putative calcipressin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Calcipressin
Other DBs
NCBI-GeneID: 2542877
NCBI-ProteinID: NP_592841
PomBase: SPAC13G6.15c
UniProt: Q09791
Position
I:complement(202487..202978)
AA seq 163 aa
MLVFTTSPDHVDELNEFVQQLNPVAFTRVLRGLGKVLASYNDKAVEEDTLKKSSTGSLPS
GQQVHCQYVLDDPNHVEGISVDQSLQVPKFEKNWLISPPGSPPVGWEPIVEESPNSQHLA
HDIQLKLDELGNALLNDHSAGPQIVISEHNNTKETSPSRQFEH
NT seq 492 nt   +upstreamnt  +downstreamnt
atgttagtctttactacgagtcccgatcacgttgacgaactgaacgaatttgttcaacaa
ctcaatccggttgcttttactcgagtgcttcgaggattggggaaggtgttggcttcttac
aatgacaaagctgttgaagaggataccctcaagaagagtagtactggttccctaccttcc
ggccaacaagtgcattgtcaatatgtattagatgatcctaatcatgttgaaggaatttct
gtagaccaatcgttacaggttccgaagtttgagaagaattggcttattagccctcctgga
tctccacctgtaggatgggaacctattgttgaagaatctcccaattcgcaacatttagct
catgatattcagcttaaattggatgaattaggtaatgcccttttgaacgatcattccgct
ggaccacaaatcgtaatttctgaacataacaatacaaaggaaacatcgccatccaggcaa
tttgaacattag

DBGET integrated database retrieval system