KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G7.05
Entry
SPAC13G7.05       CDS       T00076                                 
Symbol
are1
Name
(RefSeq) putative acyl-coA-sterol acyltransferase Are1
  KO
K00637  sterol O-acyltransferase [EC:2.3.1.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00100  Steroid biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SPAC13G7.05 (are1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.26  sterol O-acyltransferase
     SPAC13G7.05 (are1)
SSDB
Motif
Pfam: MBOAT MBOAT_2
Other DBs
NCBI-GeneID: 2542851
NCBI-ProteinID: NP_593707
PomBase: SPAC13G7.05
UniProt: Q10269
Position
I:2305345..2306958
AA seq 537 aa
MTDTPRILITPSPLSDISTTINKPNVHPSMSLLKALPECRLVVKSKGDKNNANVVEFPLD
RHKQLLIAGKVYHDYKFKPRKSIFDRVTDPNYFAKSEFRGFYVLFWLSMAAWVLQLYARS
YWQRDTLLGLPLARQVFRQFFVLFSSDFLMICLSFFSYGLQVCIEKNMIRWANLGYTIQT
LWQGFYMVLAVYWVKHRDFPIVQCVFFTLHCAVLIMKQFSYSHHMGYISEIRILHNEYEK
LLKFVRECLNSTEKDEKYTFELTFPNKPAETISTLQAEEIVALTAKYLSRQMRSEVGNVV
YPDNINFFNYVDYLLVPSLVYSMEFPRVAHFRWHYMAFKAGSTFGLLALTLALVDWYFVP
SAVAVKDLDFIGKLRIAPLLMNKIMFPAIILYLIMFYLIFDCILNAFAEITKFADRGFYG
AWWNTVTWDEFSREWNKPVHVFLMRHVYHSSISGFKLKKSHAVLLTFLISALVHEFVMLL
ATGKFRCYILTFQLLQIPLYDLQQMFAFKKRDILGNVFFWIGMFTGPSFLCILYIVF
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgacagatactcctaggatattgattactccatctccgcttagcgatataagcacaacg
attaacaaaccaaatgttcatcccagtatgagtctattgaaggctcttcccgaatgccga
ctcgttgtcaaatccaagggtgataaaaataacgcaaacgttgttgaatttcctctggat
cgtcataaacaattattaattgcaggaaaagtttaccatgattataagtttaagcctcgt
aaatcgatttttgatcgtgtaaccgatcctaattatttcgcaaaaagtgagtttagaggg
ttttatgtgcttttttggctttcaatggctgcatgggtactacagttatatgcaagaagt
tattggcaacgcgatactttgcttggtttaccactagctagacaggtctttcgccagttt
ttcgtgttgtttagctcagatttccttatgatttgcctcagcttttttagttatggttta
caagtgtgtattgagaagaacatgattagatgggctaatttgggttacacaatccaaact
ttgtggcagggcttttatatggtgttagctgtctattgggttaagcatcgagattttcca
attgttcaatgtgttttcttcacgctgcattgtgccgttctaattatgaaacaattttct
tattctcaccatatgggctatatcagtgagattcgtatattgcataatgaatacgaaaaa
cttttaaagtttgttcgtgaatgcctgaattccaccgagaaagatgagaaatacacgttt
gaactgacttttcccaataagcctgctgaaacgatatctacattgcaggcagaagaaatt
gtcgctttaacagcaaaatatttgtcacgccagatgcgtagcgaagtgggcaatgttgtt
tatcctgataacatcaatttctttaattacgttgattatttattagttccatcccttgtc
tatagtatggagtttcctagagttgcccatttccgttggcattatatggcatttaaagca
ggctccacattcggtttactagctctcaccttggctcttgtagattggtatttcgttcca
agtgctgtggctgtcaaagatcttgacttcatagggaagctacgcattgctcccttgtta
atgaacaaaattatgtttcccgctatcatactttaccttatcatgttttacctgattttt
gattgcattcttaatgcatttgctgaaatcactaaatttgccgaccgtggattttatggt
gcttggtggaatacagttacatgggatgaattttcgcgcgaatggaataagcctgtccac
gtttttctcatgagacatgtttaccattcatcaatttccggtttcaaattaaaaaaatct
cacgctgttctactcacttttttaatttccgctcttgtacacgaatttgtgatgctgctc
gcaactggtaaattccggtgttacatattaacatttcaattattacaaattcctctttat
gacctccaacaaatgtttgctttcaaaaaacgcgatatccttggtaatgtgtttttctgg
attggaatgttcactggtccttcatttttatgtatcttatacattgtcttttag

DBGET integrated database retrieval system