KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G7.11
Entry
SPAC13G7.11       CDS       T00076                                 

Definition
(RefSeq) putative respiratory complex assembly protein
  KO
K17801  mitochondrial protein MBA1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPAC13G7.11
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    SPAC13G7.11
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    SPAC13G7.11
SSDB
Motif
Pfam: MBA1 Tim44
Other DBs
NCBI-GeneID: 2542838
NCBI-ProteinID: NP_593713
PomBase: SPAC13G7.11
UniProt: Q10275
Position
I:join(2315187..2315349,2315386..2315599,2315701..2316133)
AA seq 269 aa
MNVLRTQKYWVNQFAINFACRNTYVNPMFLRYFHCAVPRAISQRALKPMDIPFLQCYIEP
IDNTSFFLHPFKKIRFWWRYLFYGWWNLKKNQFLIKRTFPDRDFSIAEIIQNALKLHSGV
NKALANHDLQQLEELCTLRTAQILKQQALNQPKCIWKLEKHISKPKLLNLSRAQADLKGE
EFFVQAVVRLHTLQSLRTDKGSPKIEKPDIENVVIQQRSWTSPIRWQLWGSVPSTPVNTV
RKTLPDGQVTFVAKPSKKSFLKQLFSGKE
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaatgttcttagaactcagaaatattgggtgaatcagttcgctatcaatttcgcttgc
agaaatacctacgttaatcctatgtttttgcgatatttccattgcgctgttcctcgtgca
ataagtcaaagggcattaaagcctatggatataccgtttttgcaatgttacattgaacct
atcgataatacatcatttttcttgcatccttttaaaaaaatacgtttttggtggagatat
ttgttctacggttggtggaatttaaaaaaaaatcaattcttgattaagcgtacctttcct
gaccgtgacttcagcatcgccgaaattattcaaaatgctttaaaacttcattctggtgtc
aacaaggcacttgctaatcatgatttacagcaattagaggaattatgtaccttgagaact
gctcaaatattaaaacaacaagctctaaaccagccaaaatgtatatggaaacttgaaaag
cacatatctaagcctaagctacttaatttgagtcgtgcccaagcagatttgaaaggcgaa
gaattttttgtacaagccgtcgtacggctgcataccctacaatctttacgaacggataaa
ggctctcccaagattgaaaagccagatatagagaatgttgttatccagcaaagatcgtgg
acttctccaattagatggcaattgtgggggtctgttccatcgaccccggtaaacacagta
agaaagacattgcctgacggacaagttacttttgttgctaagccgtcaaaaaaatcgttt
ttaaaacaactcttctccggaaaggagtag

DBGET integrated database retrieval system